Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2) AT2G40110 172 / 8e-57 Yippee family putative zinc-binding protein (.1.2) AT3G11230 168 / 4e-55 Yippee family putative zinc-binding protein (.1.2) AT3G55890 154 / 1e-49 Yippee family putative zinc-binding protein (.1) AT5G53940 133 / 3e-41 Yippee family putative zinc-binding protein (.1) AT4G27745 115 / 2e-34 Yippee family putative zinc-binding protein (.1) AT4G27740 86 / 5e-23 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027762 [exp] 258 / 6e-91 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2) Lus10028300 [exp] 177 / 2e-58 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 175 / 1e-57 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2) Lus10013992 [exp] 135 / 4e-42 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1) Lus10015416 [exp] 135 / 5e-42 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 110 / 2e-32 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 110 / 2e-32 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10007773 [exp] 108 / 8e-32 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10023244 [exp] 100 / 1e-28 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G067100 [exp] 181 / 1e-59 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.010G190000 [exp] 177 / 1e-58 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.011G115700 [exp] 144 / 1e-45 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.016G115000 [exp] 139 / 3e-43 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2) Potri.015G009200 [exp] 115 / 2e-34 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 115 / 2e-34 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 115 / 2e-34 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.003G145400 [exp] 112 / 3e-33 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.014G101600 [exp] 100 / 2e-28 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.006G015500 [exp] 98 / 2e-27 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10035531 pacid=23147624 polypeptide=Lus10035531 locus=Lus10035531.g ID=Lus10035531.BGIv1.0 annot-version=v1.0 ATGGGGAGGCTGTTTGTGATCGATTTGGAAGGAAGAATCTACAGCTGCAAGCACTGCAACACGCATCTTGGCCTTGCCGACGATATCATGTCCAAGACGT TCCGCTGCAAACATGGGAAGGCTTACCTCTTCGATAAGGTTGTCAATGTCTTATCTGGTGAAAAAGAAGACCGACAAATGATGACAGGATGGCACACCGT GGTTGACATATCATGCGTCGGTTGTGGCTCAATCGTTGGCTGGAAATACGAGGCTGCGCATGATGTGAACCAGATGTACAAAGTAGGCAAGTTCATCATA GAGAGATTTAAGGTGCGGGGTCCTGATGGAAGCCTTTTCGAAGATCTGCAGGAAGAGGGCAGCGATTCTGATGAGTAA
AA sequence Show only first row Show all	>Lus10035531 pacid=23147624 polypeptide=Lus10035531 locus=Lus10035531.g ID=Lus10035531.BGIv1.0 annot-version=v1.0 MGRLFVIDLEGRIYSCKHCNTHLGLADDIMSKTFRCKHGKAYLFDKVVNVLSGEKEDRQMMTGWHTVVDISCVGCGSIVGWKYEAAHDVNQMYKVGKFII ERFKVRGPDGSLFEDLQEEGSDSDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08990			Yippee family putative zinc-bi...		Lus10035531 [exp]	0	1
AT2G38760		ANN3, ANNAT3	annexin 3 (.1)		Lus10024174 [exp]	11.0	0.8246
					Lus10025489 [exp]	11.7	0.7356
AT5G27430			Signal peptidase subunit (.1)		Lus10040138 [exp]	16.5	0.7691
AT1G71340		AtGDPD4	glycerophosphodiester phosphod...		Lus10039158 [exp]	18.5	0.7842
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10017135 [exp]	25.7	0.7755
AT3G22550			Protein of unknown function (D...		Lus10035894 [exp]	27.4	0.7383
AT2G34040			Apoptosis inhibitory protein 5...		Lus10025428 [exp]	29.0	0.7277
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10043009 [exp]	38.5	0.7136
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10026070 [exp]	42.4	0.7551
AT1G53580		GLY3, GLX2-3, E...	GLYOXALASE 2-3, ETHE1-LIKE, gl...		Lus10020760 [exp]	49.7	0.7444

Compare expression of checked genes

Lus10035531 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.