Lus10035535 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38025 104 / 6e-28 Cysteine proteinases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027758 222 / 8e-74 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1)
Lus10021738 63 / 4e-13 AT2G38025 58 / 3e-11 Cysteine proteinases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G110400 150 / 5e-46 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10035535 pacid=23147591 polypeptide=Lus10035535 locus=Lus10035535.g ID=Lus10035535.BGIv1.0 annot-version=v1.0
ATGGTTGCAGAGAATAATATCCTTCAGCAGCTGAAACATGAAGCTGCTCACTTCGAGCTCGTCTCTTCGCCTCTTCCTTCCATTTCAGCTTCGCCGCCGC
AAACCCGCTCGTTCCCCTTCTTCTCCGCCGGCAACAGTCACCGGTTCTTCGCTCGAATCGGTCCTCCACCGCGAATGACTGACCTGAAACTTGATGTTTT
ACTTGCTGGGAATTCGTTAAAGGAATGGCTCTCAACAAAGGTATCCCCCTTAAGCCAAGGGAAGAGAGATGATGCAGATTACTTACGAATGGCAGTTAAG
GAGCTAATATGTGGCAGCAGTAATGAACGCGAACAGTATGAAGAGGCAATAATTGCAATCACAGTTGATGAACCATTGAATCGATGGAGCAGAACAAGCT
TCATCGTTGTGTTTCATCTTGACTTTGCCCATGCCAGAGGTGGGCGTGGGTCTGGCTTTCTTCCAATAGCAGAATATGGAGGCGAGTTCAGCAAGTGGAA
GAGGAAGAAAGCTGTGAGGCTTCTTTACAGTGGTCGGAACCATTATGATCTGCTTGTTTAG
AA sequence
>Lus10035535 pacid=23147591 polypeptide=Lus10035535 locus=Lus10035535.g ID=Lus10035535.BGIv1.0 annot-version=v1.0
MVAENNILQQLKHEAAHFELVSSPLPSISASPPQTRSFPFFSAGNSHRFFARIGPPPRMTDLKLDVLLAGNSLKEWLSTKVSPLSQGKRDDADYLRMAVK
ELICGSSNEREQYEEAIIAITVDEPLNRWSRTSFIVVFHLDFAHARGGRGSGFLPIAEYGGEFSKWKRKKAVRLLYSGRNHYDLLV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38025 Cysteine proteinases superfami... Lus10035535 0 1
AT2G01150 RHA2B RING-H2 finger protein 2B (.1) Lus10003617 2.4 0.7675
AT2G25560 DNAJ heat shock N-terminal dom... Lus10032540 9.9 0.7801
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10010185 12.4 0.7326
AT1G51310 transferases;tRNA (5-methylami... Lus10038747 15.7 0.7670
Lus10021443 19.5 0.7303
AT1G66730 AtLIG6 DNA LIGASE 6 (.1) Lus10033580 20.2 0.7329
AT2G40760 Rhodanese/Cell cycle control p... Lus10034243 21.6 0.7693
AT3G55140 Pectin lyase-like superfamily ... Lus10003307 24.7 0.7237
AT5G18070 DRT101 DNA-DAMAGE-REPAIR/TOLERATION 1... Lus10007548 31.4 0.7070
AT5G42250 Zinc-binding alcohol dehydroge... Lus10040457 31.7 0.7342

Lus10035535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.