Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74270 215 / 3e-74 Ribosomal protein L35Ae family protein (.1) AT1G07070 214 / 1e-73 Ribosomal protein L35Ae family protein (.1) AT1G41880 210 / 3e-72 Ribosomal protein L35Ae family protein (.1) AT3G55750 209 / 7e-72 Ribosomal protein L35Ae family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028254 [exp] 216 / 2e-74 AT1G41880 207 / 3e-71 Ribosomal protein L35Ae family protein (.1) Lus10040235 [exp] 214 / 9e-74 AT1G41880 207 / 7e-71 Ribosomal protein L35Ae family protein (.1) Lus10027754 [exp] 204 / 4e-69 AT1G74270 196 / 7e-66 Ribosomal protein L35Ae family protein (.1) Lus10021121 [exp] 194 / 6e-65 AT1G07070 197 / 6e-66 Ribosomal protein L35Ae family protein (.1) Lus10017188 [exp] 161 / 3e-47 AT2G38010 1100 / 0.0 Neutral/alkaline non-lysosomal ceramidase (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G063200 [exp] 213 / 2e-73 AT1G07070 216 / 2e-74 Ribosomal protein L35Ae family protein (.1) Potri.010G194200 [exp] 213 / 3e-73 AT1G07070 219 / 8e-76 Ribosomal protein L35Ae family protein (.1) Potri.008G059400 [exp] 212 / 4e-73 AT1G74270 216 / 1e-74 Ribosomal protein L35Ae family protein (.1) Potri.010G199400 [exp] 210 / 3e-72 AT1G07070 214 / 1e-73 Ribosomal protein L35Ae family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0575 [flax] [poplar] EFTPs PF01247 [flax] [poplar] Ribosomal_L35Ae Ribosomal protein L35Ae
Representative CDS sequence Show only first row Show all	>Lus10035539 pacid=23147654 polypeptide=Lus10035539 locus=Lus10035539.g ID=Lus10035539.BGIv1.0 annot-version=v1.0 ATGGTGAAGGAAAGACAGGGAGAGCGCGTCAGGCTCTATGTTCGAGGAACAGTTCTCGGATACAAGAGGTCGAAGTCGAACCAGTACCCGAATACTTCGC TGATTCAGATCGAGGGAGTGAACACCAAGGAAGAGGTGGATTGGTACAGGGGCAAGCGCATGGCGTATATCTACAAGGCTAAGGTGAAGACGAACGGAAG CCACTACCGCTGCATTTGGGGCAAGGTTACTAGGCCTCACGGTAACAGTGGTGTTGTCCGAGCTAAGTTCACGTCTAATCTTCCTCCCAAGTCAATGGGC GATAAAGTCAGGGTCTTCATGTATCCAAGCAACGTTTGA
AA sequence Show only first row Show all	>Lus10035539 pacid=23147654 polypeptide=Lus10035539 locus=Lus10035539.g ID=Lus10035539.BGIv1.0 annot-version=v1.0 MVKERQGERVRLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTKEEVDWYRGKRMAYIYKAKVKTNGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMG DKVRVFMYPSNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74270			Ribosomal protein L35Ae family...		Lus10035539 [exp]	0	1
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	1.0	0.8643
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	5.7	0.8117
AT4G15000			Ribosomal L27e protein family ...		Lus10027314 [exp]	6.8	0.8295
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10024229 [exp]	6.9	0.7861
AT1G47278			unknown protein		Lus10016567 [exp]	9.8	0.7768
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10023599 [exp]	11.8	0.7878
AT1G08580			unknown protein		Lus10040441 [exp]	12.2	0.8040
AT2G19730			Ribosomal L28e protein family ...		Lus10037609 [exp]	12.6	0.8070
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10024913 [exp]	13.3	0.7866
AT4G38370			Phosphoglycerate mutase family...		Lus10014434 [exp]	14.7	0.7619

Compare expression of checked genes

Lus10035539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.