Lus10035547 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22285 154 / 8e-45 Ubiquitin C-terminal hydrolases superfamily protein (.1)
AT4G22350 154 / 9e-45 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
AT4G22410 124 / 1e-34 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027746 242 / 4e-81 AT4G22285 321 / 9e-107 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10003795 207 / 7e-65 AT4G22285 713 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10010490 201 / 2e-62 AT4G22350 714 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G014000 174 / 4e-52 AT4G22350 699 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Potri.006G010100 171 / 5e-51 AT4G22350 734 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Representative CDS sequence
>Lus10035547 pacid=23147532 polypeptide=Lus10035547 locus=Lus10035547.g ID=Lus10035547.BGIv1.0 annot-version=v1.0
ATGGTGGACGAAGAAGGTTCAACGAAGAGACAGAGAGTTGAGATAGAAGGTTCATCTCGGAGTCAGGCGATTGATAATCCTCTAGTCGATGAACTTGATG
GATTAGAAGGTAGCATCCAGAAGCAATTGGAACCTCGTTCGGACTGTCCTTATCTGGACACAGTGAACCGCGAGGTGCTGGATTTCGATTTGGAGAAGTT
ATGTTCGGTGTTGATGTCGAATGTGAATCGCGAGGTGCGGGATTTTGAATCGGAGAAGTTGCGTTTGGTGTCGAATGTGAATGTGTATGCGTGTCTGGTG
TGGGAAATATTACCAAGGAAGGGGGCGAAGTCCCATGCGTATACTCACAGTGTTGAAGCAGGGCATCATGTGTATATCAACTTAGAGACTGAGAAGGTGT
ACTGTCTTCCTGACGGATATGAGATTATTGATCCTTCTTTGGATGACATACGAGATGCGCTGAATCCGAGGTTTACAAAGGAACGAGTCGAGCAGTTGGA
CTAG
AA sequence
>Lus10035547 pacid=23147532 polypeptide=Lus10035547 locus=Lus10035547.g ID=Lus10035547.BGIv1.0 annot-version=v1.0
MVDEEGSTKRQRVEIEGSSRSQAIDNPLVDELDGLEGSIQKQLEPRSDCPYLDTVNREVLDFDLEKLCSVLMSNVNREVRDFESEKLRLVSNVNVYACLV
WEILPRKGAKSHAYTHSVEAGHHVYINLETEKVYCLPDGYEIIDPSLDDIRDALNPRFTKERVEQLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22285 Ubiquitin C-terminal hydrolase... Lus10035547 0 1
AT3G30210 MYB ATMYB121 myb domain protein 121 (.1) Lus10034372 1.4 0.8041
AT1G02810 Plant invertase/pectin methyle... Lus10029866 2.0 0.7727
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Lus10024367 2.4 0.7684
AT3G16910 AAE7, ACN1 ACETATE NON-UTILIZING 1, acyl-... Lus10016861 4.5 0.7702
AT1G49570 Peroxidase superfamily protein... Lus10023858 9.2 0.7797
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10029184 9.5 0.7899
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10034334 9.8 0.7428
AT4G18050 ABCB9, PGP9 ATP-binding cassette B9, P-gly... Lus10004583 14.4 0.7588
AT4G10120 ATSPS4F Sucrose-phosphate synthase fam... Lus10006183 15.5 0.7294
Lus10033891 20.3 0.6435

Lus10035547 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.