Lus10035548 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22410 79 / 1e-17 Ubiquitin C-terminal hydrolases superfamily protein (.1)
AT4G22350 76 / 1e-16 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
AT4G22285 76 / 1e-16 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027745 199 / 6e-65 AT4G22285 150 / 2e-42 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10003795 119 / 1e-31 AT4G22285 713 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1)
Lus10010490 96 / 2e-23 AT4G22350 714 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G010100 105 / 1e-26 AT4G22350 734 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
Potri.016G014000 104 / 2e-26 AT4G22350 699 / 0.0 Ubiquitin C-terminal hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Representative CDS sequence
>Lus10035548 pacid=23147535 polypeptide=Lus10035548 locus=Lus10035548.g ID=Lus10035548.BGIv1.0 annot-version=v1.0
ATGAAAGCCAGCAACAACAGGTTTTGCGTATGGAGGCACTTTGACCCTGAGGAGTTCATGGCATGGCTTCTCTTCAGACTTCATTATAATCTTACAACTT
GGAACAAGAATATCAACATCATTTTCGATTGCTTTCAGGGGGAAATTGAGGTTGTCCAAGAAGTGATCCGGCGTGGTGCTGATCACAGTGCCACTGGTAC
AGACGGTGAGACTGAACATAGCAACGCTCTCAAGGAAACTTCGACAGAGGTGTTCATGGTGCTCAGTTTGGATTTGCCACCGCCTCCGTTGATGCCGATG
GATGTTATTCCACAGGTTCATTTATTGAACATCCTGGAGAAGATCGAGGAAGAGACCATCACCGAAGTAGACACGGATCGTGCCGTGAGGATGAACTGCC
GCTTTACCAAATTGCCTAAGTATCTTATTCTTCACATGCAACGATTCAACAACAACACAGTCTGCCTCAAGAAGAACCAAACACTAGGCCAGTTTCATCG
ATGA
AA sequence
>Lus10035548 pacid=23147535 polypeptide=Lus10035548 locus=Lus10035548.g ID=Lus10035548.BGIv1.0 annot-version=v1.0
MKASNNRFCVWRHFDPEEFMAWLLFRLHYNLTTWNKNINIIFDCFQGEIEVVQEVIRRGADHSATGTDGETEHSNALKETSTEVFMVLSLDLPPPPLMPM
DVIPQVHLLNILEKIEEETITEVDTDRAVRMNCRFTKLPKYLILHMQRFNNNTVCLKKNQTLGQFHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22410 Ubiquitin C-terminal hydrolase... Lus10035548 0 1
AT3G44150 unknown protein Lus10021005 1.0 0.9850
AT3G59140 ATMRP14, ABCC10 ATP-binding cassette C10, mult... Lus10028741 3.9 0.8819
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10021338 4.0 0.9784
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10030286 4.9 0.9784
AT5G55930 ATOPT1 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10035124 5.7 0.6807
Lus10033096 5.7 0.9784
AT1G27220 paired amphipathic helix repea... Lus10000805 6.3 0.9784
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10010229 6.9 0.9709
AT1G31450 Eukaryotic aspartyl protease f... Lus10002630 7.9 0.9598
AT5G63920 TOP3A, AtTOP3al... topoisomerase 3alpha (.1) Lus10006779 8.0 0.9576

Lus10035548 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.