Lus10035554 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32700 204 / 9e-67 PLATZ transcription factor family protein (.1.2)
AT2G27930 201 / 1e-65 PLATZ transcription factor family protein (.1)
AT1G76590 199 / 5e-64 PLATZ transcription factor family protein (.1)
AT1G21000 198 / 7e-64 PLATZ transcription factor family protein (.1.2)
AT4G17900 191 / 3e-61 PLATZ transcription factor family protein (.1.2)
AT1G43000 180 / 5e-57 PLATZ transcription factor family protein (.1)
AT5G46710 160 / 2e-49 PLATZ transcription factor family protein (.1)
AT1G31040 120 / 1e-33 PLATZ transcription factor family protein (.1)
AT2G12646 119 / 1e-32 PLATZ transcription factor family protein (.1)
AT3G60670 116 / 6e-32 PLATZ transcription factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027735 359 / 8e-128 AT1G21000 218 / 9e-72 PLATZ transcription factor family protein (.1.2)
Lus10014396 243 / 9e-82 AT1G76590 202 / 7e-66 PLATZ transcription factor family protein (.1)
Lus10040292 201 / 5e-65 AT1G21000 317 / 3e-110 PLATZ transcription factor family protein (.1.2)
Lus10023411 204 / 1e-64 AT1G21000 313 / 7e-107 PLATZ transcription factor family protein (.1.2)
Lus10040082 197 / 1e-63 AT4G17900 306 / 2e-106 PLATZ transcription factor family protein (.1.2)
Lus10030968 197 / 2e-63 AT4G17900 299 / 1e-103 PLATZ transcription factor family protein (.1.2)
Lus10000952 197 / 4e-63 AT1G21000 347 / 5e-122 PLATZ transcription factor family protein (.1.2)
Lus10002700 197 / 7e-63 AT1G21000 345 / 1e-120 PLATZ transcription factor family protein (.1.2)
Lus10004577 188 / 5e-60 AT4G17900 287 / 6e-99 PLATZ transcription factor family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G119400 276 / 4e-95 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1)
Potri.001G212400 268 / 5e-92 AT2G27930 224 / 6e-75 PLATZ transcription factor family protein (.1)
Potri.016G097100 266 / 4e-91 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2)
Potri.009G003200 259 / 3e-88 AT2G27930 227 / 3e-76 PLATZ transcription factor family protein (.1)
Potri.005G259000 202 / 2e-65 AT1G21000 366 / 1e-129 PLATZ transcription factor family protein (.1.2)
Potri.002G002200 201 / 3e-65 AT1G21000 365 / 2e-129 PLATZ transcription factor family protein (.1.2)
Potri.019G051200 197 / 1e-63 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2)
Potri.003G092800 197 / 1e-63 AT4G17900 290 / 5e-100 PLATZ transcription factor family protein (.1.2)
Potri.001G141500 195 / 6e-63 AT4G17900 302 / 5e-105 PLATZ transcription factor family protein (.1.2)
Potri.013G078500 194 / 2e-62 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04640 PLATZ PLATZ transcription factor
Representative CDS sequence
>Lus10035554 pacid=23147375 polypeptide=Lus10035554 locus=Lus10035554.g ID=Lus10035554.BGIv1.0 annot-version=v1.0
ATGTCGGTGCCGGCGTGGCTAGAGTCACTGCTGAGCACCGCCTTCTTCTCGGTCTGCCGGATTCACCGGGACTCCGCGAGGAGCGAATGCAATATGTTCT
GTTTGGATTGCAGAGGAGATCCGTTCTGCTTCTATTGCCGCTCCTCCCGCCACAAGGACCACCAAGTAATCCAGATTAGGAGATCTTCGTATCACGATGT
GGTGAGAGTCGGTGAAATACAGAAGGTTCTGGACATCAGCGGAGTACAGACGTATGTGATAAACAGCGCGAGAGTGATGTTCTTGAACGAGCGGCCGCAG
CCCAAGTCCGGCAAAGGAGTTGCTCATCTCTGTGAGATTTGTGGCCGGAGCTTGCTAGACACGTTTCGATTCTGCTCGTTGGGATGTAAGCTTGTAGGGA
TAAAGAAGAATGGAAATGCTACATTCACCATGGGAGGAGGAGGAGGAGAAGATCATCAAAATAGAGAAGCTGAAACAAGTACATCATCACTATTATTAAT
GTCATCAAGAGAAGAAAACAGAGAAATGCGTCAAGGAACAACACAAGAACAACAGCAAGAAGAAGGAATCATGTACCCGCCAGCGACGCCACCCACTTCC
AACGCACGGCGAAGAAAAGGCATTCCCCATCGCGCACCTTTCTTTGCTTCCTAA
AA sequence
>Lus10035554 pacid=23147375 polypeptide=Lus10035554 locus=Lus10035554.g ID=Lus10035554.BGIv1.0 annot-version=v1.0
MSVPAWLESLLSTAFFSVCRIHRDSARSECNMFCLDCRGDPFCFYCRSSRHKDHQVIQIRRSSYHDVVRVGEIQKVLDISGVQTYVINSARVMFLNERPQ
PKSGKGVAHLCEICGRSLLDTFRFCSLGCKLVGIKKNGNATFTMGGGGGEDHQNREAETSTSSLLLMSSREENREMRQGTTQEQQQEEGIMYPPATPPTS
NARRRKGIPHRAPFFAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21000 PLATZ transcription factor fam... Lus10035554 0 1
AT4G35320 unknown protein Lus10022985 1.7 0.8917
AT1G27200 Domain of unknown function (DU... Lus10036676 3.5 0.8495
AT1G06230 GTE4 global transcription factor gr... Lus10007096 4.0 0.7842
AT1G61100 disease resistance protein (TI... Lus10018471 4.2 0.8147
AT4G35320 unknown protein Lus10001621 4.7 0.8633
AT4G31600 UDP-N-acetylglucosamine (UAA) ... Lus10020119 5.3 0.7909
AT5G62690 TUB2 tubulin beta chain 2 (.1) Lus10035497 5.9 0.8483
AT1G61100 disease resistance protein (TI... Lus10011217 6.7 0.7875
AT2G45790 ATPMM phosphomannomutase (.1) Lus10009825 8.1 0.7965
AT1G21000 PLATZ transcription factor fam... Lus10027735 10.2 0.8508

Lus10035554 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.