Lus10035572 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G44735 39 / 3e-05 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027716 105 / 4e-31 AT3G44735 57 / 4e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2)
Lus10020548 39 / 5e-05 AT3G44735 55 / 8e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G148900 39 / 4e-05 AT3G44735 65 / 2e-15 PHYTOSULFOKINE 3 PRECURSOR (.1.2)
Potri.004G188200 39 / 7e-05 AT3G44735 69 / 9e-17 PHYTOSULFOKINE 3 PRECURSOR (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06404 PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence
>Lus10035572 pacid=23147658 polypeptide=Lus10035572 locus=Lus10035572.g ID=Lus10035572.BGIv1.0 annot-version=v1.0
ATGGGAAGAAACCATTACTCTACTCTTCTTCTTCTTGTTTTCCTGCTGGTTTCTTCGCAAGGTACTGTTGGGAGGAGGATCTCTGTAGATGATCAGAAGG
CTGGAGCAGAGCTTGCTTTTGGTTCTTCAGCTTCTCTTGATGAAGATTTCTCCATGGTAACGGGAGAAGGAGGAGTTGTCTGTGAAGACAAGGATGGAGA
AGAAGAAGAAGACTGCTTGAAGAGAAGGATGGTGGCTGAAGCTCACTTGGACTACATCTACACTCAGAGCCATAATCACCCTTGA
AA sequence
>Lus10035572 pacid=23147658 polypeptide=Lus10035572 locus=Lus10035572.g ID=Lus10035572.BGIv1.0 annot-version=v1.0
MGRNHYSTLLLLVFLLVSSQGTVGRRISVDDQKAGAELAFGSSASLDEDFSMVTGEGGVVCEDKDGEEEEDCLKRRMVAEAHLDYIYTQSHNHP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G44735 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1... Lus10035572 0 1
AT3G17220 ATPMEI2 pectin methylesterase inhibito... Lus10017347 1.0 0.9433
AT5G22580 Stress responsive A/B Barrel D... Lus10020555 3.2 0.9396
AT5G08350 GRAM domain-containing protein... Lus10017372 3.2 0.9004
AT3G44735 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1... Lus10027716 3.5 0.9357
AT1G69930 ATGSTU11 glutathione S-transferase TAU ... Lus10026722 3.7 0.8945
AT1G48590 Calcium-dependent lipid-bindin... Lus10003710 6.0 0.9080
AT3G45790 Protein kinase superfamily pro... Lus10013791 6.2 0.8961
AT2G43990 unknown protein Lus10008165 7.3 0.8820
AT1G60783 unknown protein Lus10004622 7.9 0.9064
AT2G15680 AtCML30 calmodulin-like 30, Calcium-bi... Lus10014050 8.7 0.9186

Lus10035572 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.