Lus10035574 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04865 61 / 2e-11 Aminotransferase-like, plant mobile domain family protein (.1)
AT1G17930 57 / 3e-10 Aminotransferase-like, plant mobile domain family protein (.1)
AT2G25010 56 / 6e-10 Aminotransferase-like, plant mobile domain family protein (.1)
AT1G48120 40 / 0.0002 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043081 97 / 4e-26 AT1G17930 64 / 2e-12 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000686 90 / 3e-23 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10020970 93 / 9e-23 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10027047 89 / 3e-21 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10003026 86 / 5e-21 AT2G25010 45 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10021566 84 / 3e-20 AT1G17930 54 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000980 81 / 4e-20 AT1G17930 56 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10012087 83 / 6e-20 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10000720 77 / 9e-19 AT1G17930 56 / 1e-09 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10536 PMD Plant mobile domain
Representative CDS sequence
>Lus10035574 pacid=23147438 polypeptide=Lus10035574 locus=Lus10035574.g ID=Lus10035574.BGIv1.0 annot-version=v1.0
ATGTATAGGTGCCTCGGGGAGGCTAGTCAAGCTCAGTCTTCGGGACTTTGTGGGTGCTTGACATTGTTGCAGTCATGGATCTATGAGTATTTTCCAACTT
TTCGTCCTTCCCATGATCCGACTAGTCAAAGTCCTAATAACCCGCTTGCTGGGAGGTGGGATGGCCCTGATAGATCTGATGGGACGGGAGAGAGTTTTCA
GCATAGGTTGGATTTGTACCGTCGTCACCTAGATGGGATGACGGCCCGTTCTGTGGACTGGCTTCCTTTTGGTAGTGCGCCGGCTAGAGATGACCCGAGT
AGGGGGTTGCACACGGCTAAGTCTTTGTACTGTGGAGTTATACAGATTGTGACAGGACTGAGTCGTACAATCCCTCACACGCGTTCTTCGGCAGTATGGG
TACCAACAGGTATTGCCTGA
AA sequence
>Lus10035574 pacid=23147438 polypeptide=Lus10035574 locus=Lus10035574.g ID=Lus10035574.BGIv1.0 annot-version=v1.0
MYRCLGEASQAQSSGLCGCLTLLQSWIYEYFPTFRPSHDPTSQSPNNPLAGRWDGPDRSDGTGESFQHRLDLYRRHLDGMTARSVDWLPFGSAPARDDPS
RGLHTAKSLYCGVIQIVTGLSRTIPHTRSSAVWVPTGIA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04865 Aminotransferase-like, plant m... Lus10035574 0 1
AT1G22640 MYB AtMYB3 ARABIDOPSIS THALIANA MYB DOMA... Lus10001043 1.0 0.8894
AT3G05880 RCI2A RARE-COLD-INDUCIBLE 2A, Low te... Lus10019890 4.5 0.8063
Lus10028567 12.1 0.7787
AT5G18430 GDSL-like Lipase/Acylhydrolase... Lus10004774 14.1 0.7728
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006594 16.9 0.7565
AT5G63810 BGAL10 beta-galactosidase 10 (.1) Lus10023977 17.8 0.7429
AT5G11420 Protein of unknown function, D... Lus10013112 20.2 0.7291
AT1G21400 Thiamin diphosphate-binding fo... Lus10000772 21.6 0.7330
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006593 22.6 0.7373
ATCG00490 ATCG00490.1, RB... ribulose-bisphosphate carboxyl... Lus10032825 23.2 0.7307

Lus10035574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.