Lus10035584 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53020 206 / 5e-69 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 206 / 6e-69 RPL24A ribosomal protein L24 (.1)
AT2G44860 75 / 2e-17 Ribosomal protein L24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008640 221 / 9e-75 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10024560 208 / 1e-69 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10032198 208 / 1e-69 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10006314 202 / 3e-66 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 202 / 4e-66 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Lus10014637 89 / 2e-23 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1)
Lus10020552 80 / 2e-19 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G139500 209 / 2e-70 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 209 / 3e-70 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 207 / 3e-69 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.004G085300 205 / 1e-68 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 191 / 7e-63 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.009G148500 76 / 7e-18 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 76 / 9e-18 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Lus10035584 pacid=23147481 polypeptide=Lus10035584 locus=Lus10035584.g ID=Lus10035584.BGIv1.0 annot-version=v1.0
ATGGTGCTCAAGACGGAGCTCTGCAGGTTCAGTGGGCAGAAGATTTATCCAGGGAGAGGGATCAGATTCATTCGTTCTGACTCTCAGGTGTTCCTCTTTG
CCAATTCAAAGTGCAAGAGGTATTTCCACAACAGGTTGAAGCCATCCAAGCTAACATGGACGGCAGTCTTCAGGAAGCAACATAAGAAGGACATTGCTCA
AGAGGCAGTGAAGAAGAGGCGCAGGGCTACCAAGAAGCCTTACTCTAGGTCCATTGTTGGTGCAACCTTGGAGGTTATCCAGAAGAAGAGAACCGAGAAA
CCCGAAGTTCGTGATGCTGCTAGGGAAGCTGCGATCAGAGAAATCAAGGAAAGAATCAAGAAGACGAAAGATGAGAAAAAGGCCAAGAAAGCAGAAGTGA
GCAAATCCCAAAAGTCTCAACCTAAAGGCGGTGCTGGAAGGGCTGCCCCGGCAAAGGGTCCTAAGCTCGGTGGCGGCGGTGGAAAGCGCTGA
AA sequence
>Lus10035584 pacid=23147481 polypeptide=Lus10035584 locus=Lus10035584.g ID=Lus10035584.BGIv1.0 annot-version=v1.0
MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAVFRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEK
PEVRDAAREAAIREIKERIKKTKDEKKAKKAEVSKSQKSQPKGGAGRAAPAKGPKLGGGGGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10035584 0 1
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10001681 2.0 0.9662
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10004874 2.8 0.9658
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 6.0 0.9646
AT1G53760 unknown protein Lus10037462 6.0 0.9336
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10030113 6.3 0.9613
AT1G67430 Ribosomal protein L22p/L17e fa... Lus10006421 6.5 0.9647
AT5G02610 Ribosomal L29 family protein ... Lus10019179 6.7 0.9536
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 7.7 0.9516
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10027800 7.7 0.9608
AT2G20450 Ribosomal protein L14 (.1) Lus10021170 8.9 0.9523

Lus10035584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.