Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03800 119 / 3e-31 EMB166, EMB175, EMB1899 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G03880 78 / 7e-17 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G13770 72 / 6e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G05240 72 / 1e-14 MEF19 mitochondrial editing factor 19 (.1) AT4G13650 72 / 1e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G28690 71 / 1e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G13270 71 / 3e-14 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G50270 71 / 3e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G37320 71 / 3e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G66520 71 / 3e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008637 [exp] 326 / 9e-107 AT5G03800 902 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033858 [exp] 76 / 6e-16 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030036 [exp] 74 / 2e-15 AT1G10330 436 / 5e-150 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015414 [exp] 72 / 1e-14 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022974 [exp] 72 / 1e-14 AT2G03880 542 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001617 [exp] 72 / 2e-14 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033713 [exp] 71 / 2e-14 AT1G03540 726 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10038431 [exp] 71 / 3e-14 AT4G20770 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026937 [exp] 70 / 7e-14 AT3G58590 715 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G096400 [exp] 149 / 1e-41 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.011G052300 [exp] 76 / 5e-16 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G035900 [exp] 73 / 4e-15 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1) Potri.013G103600 [exp] 72 / 7e-15 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G067500 [exp] 72 / 8e-15 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G011000 [exp] 72 / 1e-14 AT1G08070 572 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G051300 [exp] 71 / 2e-14 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G076100 [exp] 71 / 3e-14 AT4G33170 383 / 1e-121 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G058900 [exp] 70 / 6e-14 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G104700 [exp] 70 / 6e-14 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10035588 pacid=23147458 polypeptide=Lus10035588 locus=Lus10035588.g ID=Lus10035588.BGIv1.0 annot-version=v1.0 ATGATTCAATCCTCCGCCGTCACCACCATCTCGCCGCCGCTGCTGCTAACCCTAAAGTCCTTCCACTTCCGCTCCAAGCTAACAATTGCACCGCCGTCAG CTCAAAACCGTTCCGCCGCCGAGGTCAAACTTCATTGCTTTTCCGCCACTTCAGTGCAGGCCCGATTACCGAGTCACCCCAGTTTCCTTCCAACTGATTC TTCGAATGTACGGAGCCCGGAACCCGACAATGCTGATTACTACGCTTACGTCTCGATAAAATACTCCGATATCGAGCTCGCCAAAGCTGTCCACGCTTCG ATTCTCAAGCGCGAAACAGACACTTATCTGGGGAACTGTCTTATCGGAGTTTACATCAAGCTTGGGCTCGTTCTCGAGGCGTATCAGGTATTTAAGAACC TTTCTGAACCCAACGTGGTGTCGTACAGTGCACTGATTTCGGGGCTTTCAAAGTCGAATCGAGAAGCTGAAGCTGTGGAACTCTTCTTTAGGATGAGGAG TTCGGGCGTTGAGCCTAATGAGTACAGTTTTGTTGCTATACTGACTGCCGCGTTTGAACTCTGCAATCCAACTGTTCGACGAAATGCCTGA
AA sequence Show only first row Show all	>Lus10035588 pacid=23147458 polypeptide=Lus10035588 locus=Lus10035588.g ID=Lus10035588.BGIv1.0 annot-version=v1.0 MIQSSAVTTISPPLLLTLKSFHFRSKLTIAPPSAQNRSAAEVKLHCFSATSVQARLPSHPSFLPTDSSNVRSPEPDNADYYAYVSIKYSDIELAKAVHAS ILKRETDTYLGNCLIGVYIKLGLVLEAYQVFKNLSEPNVVSYSALISGLSKSNREAEAVELFFRMRSSGVEPNEYSFVAILTAAFELCNPTVRRNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03800		EMB166, EMB175,...	embryo defective 1899, EMBRYO ...		Lus10035588 [exp]	0	1
AT3G57430		OTP84	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10001220 [exp]	3.5	0.9442
AT3G03710		PDE326, PNP, RI...	resistant to inhibition with F...		Lus10001331 [exp]	4.9	0.9313
AT3G03710		PDE326, PNP, RI...	resistant to inhibition with F...		Lus10013636 [exp]	10.8	0.9200
AT1G68890			magnesium ion binding;thiamin ...		Lus10030915 [exp]	10.8	0.9167
AT3G03710		PDE326, PNP, RI...	resistant to inhibition with F...		Lus10001332 [exp]	12.0	0.9160
AT3G06980			DEA(D/H)-box RNA helicase fami...		Lus10038771 [exp]	12.6	0.9113
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Lus10042924 [exp]	13.4	0.9150
AT4G31210			DNA topoisomerase, type IA, co...		Lus10026991 [exp]	14.0	0.9144
AT3G57430		OTP84	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10038400 [exp]	15.3	0.9006
AT1G16480			Tetratricopeptide repeat (TPR)...		Lus10008829 [exp]	16.3	0.8947

Compare expression of checked genes

Lus10035588 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.