Lus10035602 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033869 79 / 6e-18 AT3G57170 464 / 4e-156 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein (.1)
Lus10014756 59 / 1e-10 AT5G11010 440 / 2e-152 Pre-mRNA cleavage complex II protein family (.1.2.3)
Lus10003249 56 / 1e-09 AT3G57170 53 / 2e-08 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G044500 47 / 1e-06 AT3G57170 470 / 1e-158 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein (.1)
PFAM info
Representative CDS sequence
>Lus10035602 pacid=23147450 polypeptide=Lus10035602 locus=Lus10035602.g ID=Lus10035602.BGIv1.0 annot-version=v1.0
ATGGTGACGCAGCTTCTTTCTCAAGTCTCAAGGGCTCTAGCTTCAATCAATCGGAAGCAGCCAGCTGCACGGCAGGCCCGAAATAAGGCAGCTACTGTTC
TCCTTTCAGCATCCATTGATGTTGTGGTAGCTTTCTGCTGCGATAAGGTCTCACTCTCGAGTTCCCAATCTAGCATTCCGGGAATCGTCCATGATATAAA
TGGAAGGATGCCTGTGTTCCTACAGGAGCAATCGTGTTTCTGTCTACTGGGTCAATGCTCCACACCCCTGAACAGCAGTGGTGAAAGCCTTAATGTCAGT
GTAGAAGAAGAGAATGAAGATGCAACCATTTTGGCGATGAACAGTGCTGCTGCTGCTGGTAAAGCTCTTAAGAGACATATTGGCTCTGACAGATCAAGCT
CCATCAAGTACAATATTTTGCTTCGTATTTGA
AA sequence
>Lus10035602 pacid=23147450 polypeptide=Lus10035602 locus=Lus10035602.g ID=Lus10035602.BGIv1.0 annot-version=v1.0
MVTQLLSQVSRALASINRKQPAARQARNKAATVLLSASIDVVVAFCCDKVSLSSSQSSIPGIVHDINGRMPVFLQEQSCFCLLGQCSTPLNSSGESLNVS
VEEENEDATILAMNSAAAAGKALKRHIGSDRSSSIKYNILLRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035602 0 1
Lus10005473 2.8 0.8210
AT1G65680 ATHEXPBETA1.4, ... expansin B2 (.1) Lus10027223 5.5 0.8103
AT5G05340 Peroxidase superfamily protein... Lus10009936 11.2 0.7623
AT2G33100 ATCSLD1 CELLULOSE-SYNTHASE LIKE D1, ce... Lus10000755 19.3 0.7418
AT1G14190 Glucose-methanol-choline (GMC)... Lus10012816 26.1 0.7155
AT1G04560 AWPM-19-like family protein (.... Lus10017578 28.5 0.6939
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10000203 43.0 0.7331
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10019030 43.0 0.7573
AT5G28010 Polyketide cyclase/dehydrase a... Lus10008930 47.1 0.7740
Lus10018646 55.4 0.7439

Lus10035602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.