Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19330 158 / 7e-48 PIRL6 plant intracellular ras group-related LRR 6 (.1) AT4G26050 151 / 4e-45 PIRL8 plant intracellular ras group-related LRR 8 (.1) AT4G29880 146 / 4e-43 PIRL7 plant intracellular ras group-related LRR 7 (.1) AT3G11330 100 / 2e-25 PIRL9 plant intracellular ras group-related LRR 9 (.1) AT5G05850 99 / 7e-25 PIRL1 plant intracellular ras group-related LRR 1 (.1) AT1G12970 90 / 1e-21 PIRL3 plant intracellular ras group-related LRR 3 (.1) AT3G26500 88 / 6e-21 PIRL2 plant intracellular ras group-related LRR 2 (.1) AT4G35470 84 / 1e-19 PIRL4, DREB1C plant intracellular ras group-related LRR 4 (.1) AT2G17440 76 / 7e-17 PIRL5 plant intracellular ras group-related LRR 5 (.1) AT3G15410 61 / 2e-11 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003229 [exp] 270 / 2e-91 AT2G19330 408 / 4e-142 plant intracellular ras group-related LRR 6 (.1) Lus10013689 [exp] 96 / 1e-23 AT3G11330 473 / 3e-165 plant intracellular ras group-related LRR 9 (.1) Lus10017948 [exp] 95 / 3e-23 AT3G11330 557 / 0.0 plant intracellular ras group-related LRR 9 (.1) Lus10035976 [exp] 86 / 4e-20 AT4G35470 652 / 0.0 plant intracellular ras group-related LRR 4 (.1) Lus10004559 [exp] 79 / 1e-18 AT4G35470 274 / 1e-89 plant intracellular ras group-related LRR 4 (.1) Lus10016684 [exp] 81 / 2e-18 AT1G55325 733 / 0.0 MACCHI-BOU 2, GRAND CENTRAL, RNA polymerase II transcription mediators (.1.2) Lus10000900 [exp] 77 / 7e-17 AT4G35470 409 / 2e-138 plant intracellular ras group-related LRR 4 (.1) Lus10038948 [exp] 59 / 6e-11 AT1G68780 404 / 2e-138 RNI-like superfamily protein (.1) Lus10000681 [exp] 58 / 1e-10 AT5G07910 357 / 2e-125 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G139700 [exp] 173 / 7e-54 AT2G19330 406 / 2e-141 plant intracellular ras group-related LRR 6 (.1) Potri.006G072700 [exp] 170 / 2e-52 AT2G19330 416 / 4e-145 plant intracellular ras group-related LRR 6 (.1) Potri.010G046500 [exp] 102 / 3e-26 AT1G12970 493 / 7e-173 plant intracellular ras group-related LRR 3 (.1) Potri.012G085600 [exp] 102 / 6e-26 AT3G11330 427 / 8e-146 plant intracellular ras group-related LRR 9 (.1) Potri.015G083800 [exp] 100 / 2e-25 AT3G11330 471 / 9e-163 plant intracellular ras group-related LRR 9 (.1) Potri.007G065000 [exp] 91 / 7e-22 AT4G35470 693 / 0.0 plant intracellular ras group-related LRR 4 (.1) Potri.005G098600 [exp] 85 / 6e-20 AT4G35470 672 / 0.0 plant intracellular ras group-related LRR 4 (.1) Potri.001G144100 [exp] 81 / 2e-18 AT4G35470 448 / 6e-153 plant intracellular ras group-related LRR 4 (.1) Potri.003G090100 [exp] 69 / 2e-14 AT2G17440 416 / 2e-140 plant intracellular ras group-related LRR 5 (.1) Potri.012G121725 [exp] 63 / 1e-12 AT3G14470 94 / 9e-22 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10035622 pacid=23147445 polypeptide=Lus10035622 locus=Lus10035622.g ID=Lus10035622.BGIv1.0 annot-version=v1.0 ATGAACTCAAAATTCCTCGACTTCCTCCCAGCATCGATAACCCACCTCACTTCCTTAAGAACACTCGACGCCCGCCTCAACAAACTAAGATCCTTACCGG AAGACATCGACAACCTCATCCACCTCCAGATCCTCAACGTCAGCCAGAACTTCCACTTCCTCGAGAGCTTACCCCACGCCGTCGGAATGCTCATCTCCCT CGAGGAGCTTGACGTTAGCTACAACAAGATCAGGACGCTGCCGAACTCCATCGGCGGGCTCAAGAGGCTGAGGAAGCTCGGCGTCGAAGGGAACGCTCTC GCTTTGCCGCTGGCGGAGGTGGTGGAGCACGGCGTGCACGCCGTTAAGGACTACTTGACTGGCCGGAAGATGAACGGCGGGGAGGATGTGGTTAGTCATC ATCACGGTGGCCGGAAGAAGAAATTTTTCATGGGCAGATGA
AA sequence Show only first row Show all	>Lus10035622 pacid=23147445 polypeptide=Lus10035622 locus=Lus10035622.g ID=Lus10035622.BGIv1.0 annot-version=v1.0 MNSKFLDFLPASITHLTSLRTLDARLNKLRSLPEDIDNLIHLQILNVSQNFHFLESLPHAVGMLISLEELDVSYNKIRTLPNSIGGLKRLRKLGVEGNAL ALPLAEVVEHGVHAVKDYLTGRKMNGGEDVVSHHHGGRKKKFFMGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19330		PIRL6	plant intracellular ras group-...		Lus10035622 [exp]	0	1
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Lus10020392 [exp]	13.0	0.7223
AT2G15130			Plant basic secretory protein ...		Lus10013864 [exp]	38.2	0.6631
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10042419 [exp]	38.7	0.6908
					Lus10039450 [exp]	39.0	0.6857
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10016452 [exp]	39.8	0.6603
					Lus10000298 [exp]	42.5	0.6869
					Lus10007186 [exp]	43.2	0.6889
AT2G04220			Plant protein of unknown funct...		Lus10032896 [exp]	43.8	0.6858
					Lus10038080 [exp]	50.0	0.6800
					Lus10033211 [exp]	57.8	0.6698

Compare expression of checked genes

Lus10035622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.