Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46860 42 / 3e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38870 40 / 1e-05 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 38 / 0.0001 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43580 36 / 0.0005 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003225 [exp] 162 / 1e-53 AT2G38900 42 / 1e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10024370 [exp] 96 / 4e-27 AT2G38870 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10010859 [exp] 94 / 4e-26 AT2G38900 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10018783 [exp] 55 / 3e-11 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10032655 [exp] 54 / 9e-10 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10043097 [exp] 54 / 1e-09 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10018784 [exp] 45 / 2e-07 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10002732 [exp] 44 / 4e-07 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 40 / 2e-05 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G088700 [exp] 92 / 2e-25 ND / Potri.006G088500 [exp] 91 / 6e-25 ND / Potri.006G088616 [exp] 91 / 1e-24 ND / Potri.006G088664 [exp] 89 / 2e-24 ND / Potri.011G110100 [exp] 50 / 1e-09 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.006G212000 [exp] 50 / 2e-09 AT2G38870 81 / 5e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110400 [exp] 50 / 2e-09 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 49 / 5e-09 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 48 / 1e-08 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G079050 [exp] 46 / 4e-08 AT2G38870 81 / 2e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10035626 pacid=23147400 polypeptide=Lus10035626 locus=Lus10035626.g ID=Lus10035626.BGIv1.0 annot-version=v1.0 ATGGCGGACGGAAACAGTCAGAACAACTGTACAACGGAGGAGCAACAACCTTCAGAGCCAAAGCAACCCTCAGAGCCAAAGGTAATCCCAGGGTTTCAGA GGAGAAGCAAATCGCAGTGGCCTGAACTAGTTGGGCTACCAGCTGAAGAAGCCGAAGCCAAGATCAAAGAAGACATGGAAGGCGCTCTAGTTCAGGTGGT TCCTCCTAATCACTTCGTTACCATGGATTTCCGCCGGAATCGGGTTCGGCTGTATGTAGATTCCGAGGGCAAAATCGCCAGAGCCCCTATAATTGGCTGA
AA sequence Show only first row Show all	>Lus10035626 pacid=23147400 polypeptide=Lus10035626 locus=Lus10035626.g ID=Lus10035626.BGIv1.0 annot-version=v1.0 MADGNSQNNCTTEEQQPSEPKQPSEPKVIPGFQRRSKSQWPELVGLPAEEAEAKIKEDMEGALVQVVPPNHFVTMDFRRNRVRLYVDSEGKIARAPIIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	0	1
AT2G32260		ATCCT1	phosphorylcholine cytidylyltra...		Lus10003808 [exp]	1.7	0.9337
AT2G38900			Serine protease inhibitor, pot...		Lus10003225 [exp]	2.0	0.9154
AT3G58670			Protein of unknown function (D...		Lus10033603 [exp]	3.2	0.8926
AT4G32440			Plant Tudor-like RNA-binding p...		Lus10018749 [exp]	3.2	0.9289
AT2G16530			3-oxo-5-alpha-steroid 4-dehydr...		Lus10042055 [exp]	3.5	0.9163
AT2G36970			UDP-Glycosyltransferase superf...		Lus10016127 [exp]	3.7	0.8983
AT5G64010			unknown protein		Lus10035852 [exp]	4.2	0.8887
AT1G53580		GLY3, GLX2-3, E...	GLYOXALASE 2-3, ETHE1-LIKE, gl...		Lus10020760 [exp]	4.7	0.8792
AT5G52580			RabGAP/TBC domain-containing p...		Lus10027697 [exp]	5.9	0.8709
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Lus10026038 [exp]	7.1	0.9037

Compare expression of checked genes

Lus10035626 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.