Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64530 207 / 1e-68 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) AT1G61110 105 / 3e-27 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G52890 101 / 6e-26 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G15500 100 / 2e-25 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT4G27410 97 / 2e-24 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G15510 97 / 5e-24 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G69490 92 / 8e-23 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT3G04070 93 / 1e-22 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G01720 91 / 4e-22 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 87 / 4e-21 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000206 [exp] 290 / 3e-101 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035648 [exp] 290 / 3e-101 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10010747 [exp] 275 / 3e-95 AT5G64530 259 / 4e-89 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10011215 [exp] 110 / 4e-29 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 109 / 2e-28 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10032657 [exp] 108 / 4e-28 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 107 / 7e-28 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10006547 [exp] 104 / 2e-26 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10003269 [exp] 102 / 9e-26 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G022800 [exp] 182 / 7e-59 AT5G64530 231 / 5e-78 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.001G206900 [exp] 178 / 4e-57 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.007G105000 [exp] 162 / 1e-50 AT5G64530 183 / 3e-59 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.005G064100 [exp] 151 / 1e-46 AT5G64530 199 / 3e-65 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.004G038000 [exp] 108 / 1e-28 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 107 / 6e-28 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G123500 [exp] 104 / 6e-27 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 102 / 3e-26 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.008G089000 [exp] 97 / 1e-24 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.011G123300 [exp] 96 / 7e-24 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10035647 pacid=23147412 polypeptide=Lus10035647 locus=Lus10035647.g ID=Lus10035647.BGIv1.0 annot-version=v1.0 ATGAACCTGCCTCCTGGTTTCCGATTCTACCCTACTGACGAGGAACTTGTAGTCCACTTCCTCCATCGCAAAGCTACCCTTTTACCATGCCACCCTGACG TCATCCCTGATCTCGACCTCTACCCTTACGATCCTTGGGACCTCCATGGCAAGGCGTTGGAAGAAGGGAATCAGTGGTACTTCTACAGCAGGAAGACTCA GAACCGGGTGACCGAGAATGGGTTCTGGAAAACCATAGGGATGGAGGAGCCGATTATTTCATCAAGTGGCAACAACAGGAGGGTTGGAGTTAAGAAGTAT TTGATGTTCTTCTTGGGTGGAGATGTCAAAACTAACTGGATCATGGAGGAGTTTCGTCTCCCCGATCCCTCCTCTGGTACTGGTACTAGTACCAGTAGGT CATCATCAAGAAGTACACGATCACGGTCCAGACCGGACTACAACAAGTGGGTAGTTTGCAGAGTGTATGAGCGAAACTCGAGTGACGACGAGGAGGATGG GTCGACGGGGCTATCGTGCTTGGATGAAGTGTTCCTGTCGTTGGATGATCTCGACGACATTAGTTTGCCTTATAATTAA
AA sequence Show only first row Show all	>Lus10035647 pacid=23147412 polypeptide=Lus10035647 locus=Lus10035647.g ID=Lus10035647.BGIv1.0 annot-version=v1.0 MNLPPGFRFYPTDEELVVHFLHRKATLLPCHPDVIPDLDLYPYDPWDLHGKALEEGNQWYFYSRKTQNRVTENGFWKTIGMEEPIISSSGNNRRVGVKKY LMFFLGGDVKTNWIMEEFRLPDPSSGTGTSTSRSSSRSTRSRSRPDYNKWVVCRVYERNSSDDEEDGSTGLSCLDEVFLSLDDLDDISLPYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Lus10035647 [exp]	0	1
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Lus10035648 [exp]	1.0	0.9937
AT5G54390		ATAHL, AHL	HAL2-like (.1)		Lus10011231 [exp]	1.7	0.9015
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Lus10000206 [exp]	2.0	0.9462
AT4G33090		ATAPM1, APM1	aminopeptidase M1 (.1)		Lus10025002 [exp]	5.9	0.8811
AT3G09920		PIP5K9	phosphatidyl inositol monophos...		Lus10014408 [exp]	6.0	0.8068
AT4G15610			Uncharacterised protein family...		Lus10033972 [exp]	7.5	0.8946
AT1G13130			Cellulase (glycosyl hydrolase ...		Lus10011403 [exp]	9.8	0.8248
AT4G21550	B3	HSI2-L2, VAL3	VP1/ABI3-like 3 (.1)		Lus10014169 [exp]	14.0	0.7670
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	17.5	0.8208
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	18.8	0.8208

Compare expression of checked genes

Lus10035647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.