Lus10035659 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
AT3G04300 126 / 2e-38 RmlC-like cupins superfamily protein (.1)
AT4G28703 102 / 1e-28 RmlC-like cupins superfamily protein (.1)
AT4G10280 95 / 3e-25 RmlC-like cupins superfamily protein (.1)
AT4G10290 81 / 3e-20 RmlC-like cupins superfamily protein (.1)
AT2G32180 61 / 4e-12 PTAC18 plastid transcriptionally active 18 (.1)
AT2G32650 61 / 4e-12 RmlC-like cupins superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037245 159 / 2e-50 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1)
Lus10035660 155 / 2e-48 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Lus10025947 115 / 2e-33 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1)
Lus10014252 113 / 1e-32 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1)
Lus10030017 63 / 8e-13 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1)
Lus10035307 57 / 9e-11 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G089600 177 / 1e-57 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
Potri.002G254800 119 / 3e-35 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
Potri.014G156900 60 / 8e-12 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF05899 Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence
>Lus10035659 pacid=23147545 polypeptide=Lus10035659 locus=Lus10035659.g ID=Lus10035659.BGIv1.0 annot-version=v1.0
ATGGCGATGAATGTCGTGGCGGGTACATGGACTGGGAGCTGCTTAGCAGTAGCGAACGATAATAAATTCACCGCGATAAAGCCAAAAGCATTTTTGGTCT
CTCCTCCTAGAGCTGCAGCTTTTCTGTGTTTGTCAAGACGAGAGAGCATCGCCGGGCAGCAGCAGCGGCGGCGTTGTAGAGTAATGGCGACCCCGAAGGC
AGAGGCTACAGGCACTGCGACGACTACGATTGAGAAATCGGGAATCAAGATCGTTAGAAACCCTCCCGAATCCAAACTCTCCGACCTCGGCGTTCGTTCT
TGGCCCAAGTGGGGTTGTCCTCCAAGCAAGTTTCCATGGACATATTCTTCGAGGGAGACGTGCTATCTTCTCCAAGGAAAGGTAAAGGTTTATCCTGAAG
GATCGGATGAAGGTGTTGAAATCGCTGCAGGAGACTTGGTTGAGTTCCCAAATGGGATGAGCTGCACTTGGGACGTCTCTGTTTCCGTTGATAAGCACTA
TAAGTTCGATTGA
AA sequence
>Lus10035659 pacid=23147545 polypeptide=Lus10035659 locus=Lus10035659.g ID=Lus10035659.BGIv1.0 annot-version=v1.0
MAMNVVAGTWTGSCLAVANDNKFTAIKPKAFLVSPPRAAAFLCLSRRESIAGQQQRRRCRVMATPKAEATGTATTTIEKSGIKIVRNPPESKLSDLGVRS
WPKWGCPPSKFPWTYSSRETCYLLQGKVKVYPEGSDEGVEIAAGDLVEFPNGMSCTWDVSVSVDKHYKFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10300 RmlC-like cupins superfamily p... Lus10035659 0 1
AT3G05170 Phosphoglycerate mutase family... Lus10024659 1.4 0.9412
AT2G37920 EMB1513 embryo defective 1513, copper ... Lus10024339 2.4 0.9248
AT5G20935 unknown protein Lus10013382 2.4 0.9255
AT1G61600 Protein of unknown function (D... Lus10035379 4.0 0.9118
AT1G61600 Protein of unknown function (D... Lus10035372 4.2 0.9018
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10017961 5.3 0.9036
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Lus10020729 5.5 0.9101
AT2G36145 unknown protein Lus10014224 6.0 0.9081
AT3G05170 Phosphoglycerate mutase family... Lus10032291 6.2 0.8993
AT5G64460 Phosphoglycerate mutase family... Lus10007093 6.9 0.8708

Lus10035659 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.