Lus10035660 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10300 146 / 2e-45 RmlC-like cupins superfamily protein (.1)
AT3G04300 103 / 5e-29 RmlC-like cupins superfamily protein (.1)
AT4G10280 94 / 1e-24 RmlC-like cupins superfamily protein (.1)
AT4G28703 86 / 5e-22 RmlC-like cupins superfamily protein (.1)
AT4G10290 74 / 4e-17 RmlC-like cupins superfamily protein (.1)
AT2G32180 59 / 3e-11 PTAC18 plastid transcriptionally active 18 (.1)
AT2G32650 59 / 4e-11 RmlC-like cupins superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037245 219 / 1e-73 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1)
Lus10035659 155 / 3e-48 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1)
Lus10025947 96 / 2e-25 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1)
Lus10014252 91 / 5e-24 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1)
Lus10030017 64 / 3e-13 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1)
Lus10035307 57 / 2e-10 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G089600 158 / 7e-50 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
Potri.002G254800 100 / 1e-27 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
Potri.014G156900 59 / 4e-11 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF05899 Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence
>Lus10035660 pacid=23147425 polypeptide=Lus10035660 locus=Lus10035660.g ID=Lus10035660.BGIv1.0 annot-version=v1.0
ATGGCATGGACGACGGCGGATCTCCGTCTGCTTGCCTCCATCTTGATCTCGCTCTTGGCTCTTACTTCTCAAGCTCAACAAAGCGACATCAACGAACAGA
AACGCCAGAGAAGTGAGGACGGAAATGGAATCCATGAGACGACGAAGGTTGATTCATCAGCAGCAATAATGATACCCACGGGACGAGGACGACTCACGAG
CTTCTCCAGGCGGCGGATTATGGAGGAGGACCCCCTCACTGCCACTGTAACAGAAACAGTTGATAAATCGGGAATTAAGGTCGTCAAGAATCCTCCAGAC
TCAAAGCTTGCTGCACTCGGAGTCCGCTCATGGCCGAGATGGGCATTTGCTCCGAGCAAATTCCCATGGACATATTCGGCGAATGAGACATCGTATCTAT
TGGAAGGGAAGGCAAAGGTATACCCAGAGGGATCAGAGCAAGGCATTGAGATCACTGGTGGTGACTTGATTGATTTCCCTAAAGGGTTGAGCTGCACTTG
GGAAGTTTCTGTTGCCATTTTCAAGCACTACAAGTTCAATCAGTGA
AA sequence
>Lus10035660 pacid=23147425 polypeptide=Lus10035660 locus=Lus10035660.g ID=Lus10035660.BGIv1.0 annot-version=v1.0
MAWTTADLRLLASILISLLALTSQAQQSDINEQKRQRSEDGNGIHETTKVDSSAAIMIPTGRGRLTSFSRRRIMEEDPLTATVTETVDKSGIKVVKNPPD
SKLAALGVRSWPRWAFAPSKFPWTYSANETSYLLEGKAKVYPEGSEQGIEITGGDLIDFPKGLSCTWEVSVAIFKHYKFNQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10300 RmlC-like cupins superfamily p... Lus10035660 0 1
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10020360 1.4 0.9557
AT5G03380 Heavy metal transport/detoxifi... Lus10023924 3.5 0.9482
AT3G43740 Leucine-rich repeat (LRR) fami... Lus10002117 4.0 0.9361
AT1G14820 Sec14p-like phosphatidylinosit... Lus10034577 5.7 0.9432
AT5G41810 unknown protein Lus10001907 6.0 0.9456
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012869 9.2 0.9297
AT4G27290 S-locus lectin protein kinase ... Lus10038553 9.4 0.9348
AT4G31450 RING/U-box superfamily protein... Lus10020145 9.9 0.9376
AT5G05340 Peroxidase superfamily protein... Lus10029062 10.0 0.9387
AT3G10915 Reticulon family protein (.1.2... Lus10034224 12.0 0.9378

Lus10035660 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.