Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67390 52 / 4e-09 F-box family protein (.1) AT3G58880 47 / 3e-07 F-box/RNI-like superfamily protein (.1) AT5G02910 46 / 9e-07 F-box/RNI-like superfamily protein (.1.2) AT3G59000 45 / 1e-06 F-box/RNI-like superfamily protein (.1.2) AT3G59210 44 / 3e-06 F-box/RNI-like superfamily protein (.1.2.3.4) AT3G60790 44 / 5e-06 F-box family protein (.1) AT4G13960 44 / 5e-06 F-box/RNI-like superfamily protein (.1) AT3G59170 44 / 5e-06 F-box/RNI-like superfamily protein (.1) AT2G04230 43 / 7e-06 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) AT1G16930 43 / 7e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031018 [exp] 49 / 9e-08 AT3G59250 57 / 1e-08 F-box/RNI-like superfamily protein (.1) Lus10020292 [exp] 49 / 1e-07 AT1G60410 76 / 9e-15 F-box family protein (.1) Lus10008295 [exp] 47 / 3e-07 AT1G78840 67 / 2e-13 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10035564 [exp] 47 / 3e-07 AT3G58900 79 / 1e-16 F-box/RNI-like superfamily protein (.1.2.3.4) Lus10037289 [exp] 47 / 5e-07 AT5G02920 61 / 4e-10 F-box/RNI-like superfamily protein (.1) Lus10040760 [exp] 47 / 6e-07 AT1G13570 157 / 3e-43 F-box/RNI-like superfamily protein (.1) Lus10030031 [exp] 45 / 7e-07 AT2G04230 53 / 4e-09 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Lus10029357 [exp] 45 / 2e-06 AT3G28410 79 / 1e-15 F-box/RNI-like superfamily protein (.1) Lus10027244 [exp] 44 / 5e-06 AT5G02930 69 / 2e-12 F-box/RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G106600 [exp] 50 / 3e-08 AT5G56420 80 / 4e-16 F-box/RNI-like/FBD-like domains-containing protein (.1.2) Potri.015G002001 [exp] 48 / 1e-07 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1) Potri.011G098700 [exp] 47 / 3e-07 AT1G80960 86 / 6e-18 F-box and Leucine Rich Repeat domains containing protein (.1.2.3) Potri.014G039700 [exp] 44 / 4e-06 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1) Potri.015G002100 [exp] 42 / 1e-05 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1) Potri.011G104300 [exp] 41 / 5e-05 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.002G132400 [exp] 40 / 8e-05 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1) Potri.012G099400 [exp] 39 / 0.0002 AT5G44950 77 / 1e-14 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.015G011200 [exp] 39 / 0.0003 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.011G104200 [exp] 37 / 0.0008 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10035669 pacid=23147460 polypeptide=Lus10035669 locus=Lus10035669.g ID=Lus10035669.BGIv1.0 annot-version=v1.0 ATGGCAACACCCCGGTCTAATCAAGTCTATGGTGTTGAAAAGAGGGGCAGTAGAATACCTTGCTATAATGCAGATGATCGAATCAGTATGCTGCCTGATG ATGTCCTCCACCTTATATTGTCTTCCATGACGATTAAGGAAGCCACTGTTACCAGACTCTTTTCTAGACGATGGAGGTACTTTTCGACGTGGGCATCCTT TTGTTGTCTTAGCTTTGACACCTCTATCCTCCCAAGTGAGCTCAACTTTAGATTGTATGGCAACTATGACACAGAAGATTTCAGATTTCAGATCTTCGGG CTGAAGAGTTCAAAGAAGAGAAGCTAA
AA sequence Show only first row Show all	>Lus10035669 pacid=23147460 polypeptide=Lus10035669 locus=Lus10035669.g ID=Lus10035669.BGIv1.0 annot-version=v1.0 MATPRSNQVYGVEKRGSRIPCYNADDRISMLPDDVLHLILSSMTIKEATVTRLFSRRWRYFSTWASFCCLSFDTSILPSELNFRLYGNYDTEDFRFQIFG LKSSKKRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58880			F-box/RNI-like superfamily pro...		Lus10035669 [exp]	0	1
AT1G22810	AP2_ERF		Integrase-type DNA-binding sup...		Lus10009468 [exp]	2.0	0.9521
AT1G55230			Family of unknown function (DU...		Lus10039191 [exp]	2.8	0.9385
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10029385 [exp]	3.7	0.9299
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10019915 [exp]	7.1	0.9410
AT4G37390		AUR3, YDK1, GH3...	YADOKARI 1, AUXIN UPREGULATED ...		Lus10014869 [exp]	7.7	0.9201
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10023901 [exp]	9.4	0.8790
AT3G25160			ER lumen protein retaining rec...		Lus10038198 [exp]	12.1	0.8626
AT1G14550			Peroxidase superfamily protein...		Lus10024205 [exp]	13.3	0.9412
AT1G14205			Ribosomal L18p/L5e family prot...		Lus10012820 [exp]	14.7	0.9318
AT1G11410			S-locus lectin protein kinase ...		Lus10007608 [exp]	18.2	0.8685

Compare expression of checked genes

Lus10035669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.