Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016917 [exp] 75 / 1e-18 AT4G34770 48 / 3e-08 SAUR-like auxin-responsive protein family (.1) Lus10016914 [exp] 71 / 3e-17 AT4G34770 47 / 5e-08 SAUR-like auxin-responsive protein family (.1) Lus10039962 [exp] 38 / 0.0001 AT5G18080 50 / 1e-09 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Lus10027690 [exp] 37 / 0.0004 AT5G18020 52 / 2e-10 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10035708 pacid=23147368 polypeptide=Lus10035708 locus=Lus10035708.g ID=Lus10035708.BGIv1.0 annot-version=v1.0 ATGCCAATAATGTCTCGATCGTCCGGTTCGCACGGCGGCGGCGTATACTCGGCGGTGAAGAAGCTCCTCCGCAGACGGCCAAAGAAGGGGCACATATTCG TGTATATCGGGGAGAAGCTGAAGAGATTCGAGGTGTCGATCGAGGATTTCAATGGCCGGGTGGGCGAACTGGTGCTGGATTCGTTGGATCCGGCGGACAA GCTGGATATCCGGTGCCCTAATCCGTTTGAGATAAGGTCGTGCTCGGTGGAGAGGTTCCGTCGGCTTCTGAGTGAGATTGAGGAAGAGCGCAATCCAGAA CCAACCTACGGAATCCAGTACTAG
AA sequence Show only first row Show all	>Lus10035708 pacid=23147368 polypeptide=Lus10035708 locus=Lus10035708.g ID=Lus10035708.BGIv1.0 annot-version=v1.0 MPIMSRSSGSHGGGVYSAVKKLLRRRPKKGHIFVYIGEKLKRFEVSIEDFNGRVGELVLDSLDPADKLDIRCPNPFEIRSCSVERFRRLLSEIEEERNPE PTYGIQY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035708 [exp]	0	1
AT4G35160			O-methyltransferase family pro...		Lus10008538 [exp]	12.5	0.7538
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10023901 [exp]	13.0	0.7405
					Lus10033709 [exp]	13.9	0.6982
					Lus10041547 [exp]	20.1	0.7013
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10009399 [exp]	21.9	0.7264
					Lus10004431 [exp]	23.0	0.7140
AT3G27810	MYB	AtMYB3, ATMYB21	ARABIDOPSIS THALIANA MYB DOMA...		Lus10022259 [exp]	34.5	0.7036
					Lus10006897 [exp]	36.5	0.6993
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031157 [exp]	41.2	0.7005
AT1G06645			2-oxoglutarate (2OG) and Fe(II...		Lus10033876 [exp]	42.7	0.6855

Compare expression of checked genes

Lus10035708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.