Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20190 100 / 6e-26 Leucine-rich repeat protein kinase family protein (.1) AT1G50610 90 / 4e-22 Leucine-rich repeat protein kinase family protein (.1) AT1G72460 89 / 9e-22 Leucine-rich repeat protein kinase family protein (.1) AT4G31250 84 / 7e-20 Leucine-rich repeat protein kinase family protein (.1) AT5G35390 82 / 2e-19 Leucine-rich repeat protein kinase family protein (.1) AT2G07040 74 / 2e-16 ATPRK2A Leucine-rich repeat protein kinase family protein (.1) AT3G42880 56 / 4e-10 Leucine-rich repeat protein kinase family protein (.1) AT5G20690 55 / 7e-10 Leucine-rich repeat protein kinase family protein (.1) AT4G20940 49 / 8e-08 Leucine-rich receptor-like protein kinase family protein (.1) AT1G68400 49 / 1e-07 leucine-rich repeat transmembrane protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033339 [exp] 132 / 3e-37 AT3G20190 600 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10027597 [exp] 96 / 2e-24 AT5G35390 603 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10022946 [exp] 95 / 6e-24 AT5G35390 593 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10017144 [exp] 87 / 6e-21 AT5G35390 597 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10008128 [exp] 78 / 8e-18 AT1G72460 412 / 8e-137 Leucine-rich repeat protein kinase family protein (.1) Lus10015678 [exp] 76 / 6e-17 AT1G72460 466 / 7e-157 Leucine-rich repeat protein kinase family protein (.1) Lus10037687 [exp] 70 / 3e-15 AT1G72460 212 / 4e-64 Leucine-rich repeat protein kinase family protein (.1) Lus10013165 [exp] 69 / 8e-15 AT5G20690 470 / 5e-158 Leucine-rich repeat protein kinase family protein (.1) Lus10005175 [exp] 67 / 4e-14 AT5G20690 417 / 1e-138 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G002700 [exp] 111 / 1e-29 AT3G20190 415 / 1e-136 Leucine-rich repeat protein kinase family protein (.1) Potri.007G002000 [exp] 110 / 3e-29 AT3G20190 437 / 4e-145 Leucine-rich repeat protein kinase family protein (.1) Potri.006G078600 [exp] 84 / 6e-20 AT5G35390 660 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.018G147300 [exp] 79 / 3e-18 AT5G35390 629 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.001G166300 [exp] 75 / 6e-17 AT3G42880 513 / 6e-174 Leucine-rich repeat protein kinase family protein (.1) Potri.006G279300 [exp] 73 / 3e-16 AT4G31250 570 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.003G068800 [exp] 71 / 2e-15 AT3G42880 471 / 6e-159 Leucine-rich repeat protein kinase family protein (.1) Potri.006G139700 [exp] 70 / 4e-15 AT3G42880 611 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.018G002600 [exp] 67 / 4e-14 AT3G20190 540 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.006G228400 [exp] 52 / 7e-09 AT1G68400 357 / 3e-114 leucine-rich repeat transmembrane protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10035709 pacid=23147663 polypeptide=Lus10035709 locus=Lus10035709.g ID=Lus10035709.BGIv1.0 annot-version=v1.0 ATGCCCGCAGCCGTTTTCGGAGGACCAGCTCTCCAATCCGACGCGCTGCTGAAATTCAAAGCAGGTTTAGGGAACAACGCCGCCCTGGGGACGTGGGACC CGGCGGTGGACCCATGTTTAGGCGCCCGCTCAAACTGGGCGGGCGTCCTGTGCTCGGACAACAATGTGTGGGGCCTACAGCTGGAGCACATGCAGCTGAC GGGAACTGTCGACGTGGACGCCCTCTCAGCCATCGACAACTTCCGTACGTTAAGCCTGATGGACAACAGGCTGTCGGGGGCCTTGCCCGGGGGGGCCGGA GGTGAGGAAGCTGGGGAAGCTCAAATCGTTGTTTTTGTCTAA
AA sequence Show only first row Show all	>Lus10035709 pacid=23147663 polypeptide=Lus10035709 locus=Lus10035709.g ID=Lus10035709.BGIv1.0 annot-version=v1.0 MPAAVFGGPALQSDALLKFKAGLGNNAALGTWDPAVDPCLGARSNWAGVLCSDNNVWGLQLEHMQLTGTVDVDALSAIDNFRTLSLMDNRLSGALPGGAG GEEAGEAQIVVFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20190			Leucine-rich repeat protein ki...		Lus10035709 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000558 [exp]	3.9	1.0000
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	5.5	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	6.7	1.0000
AT3G02310	MADS	AGL4, SEP2	SEPALLATA 2, AGAMOUS-like 4, K...		Lus10034371 [exp]	7.2	1.0000
					Lus10011636 [exp]	7.7	1.0000
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	8.7	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	9.5	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	10.2	1.0000
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	11.0	1.0000
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	11.6	1.0000

Compare expression of checked genes

Lus10035709 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.