Lus10035711 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16760 188 / 3e-55 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT1G78940 177 / 2e-51 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
AT3G20200 177 / 4e-51 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT2G24370 164 / 2e-46 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT4G31230 149 / 4e-41 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT2G07020 132 / 2e-35 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G35380 119 / 1e-30 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G20310 110 / 2e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G17540 106 / 3e-26 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G12000 102 / 1e-24 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037298 392 / 2e-132 AT1G16760 820 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10033340 233 / 2e-71 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10020184 164 / 9e-50 AT2G24370 286 / 2e-91 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10026989 162 / 1e-45 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10024212 143 / 7e-39 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10021596 139 / 2e-37 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10027592 125 / 3e-35 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10042205 131 / 1e-34 AT1G16760 691 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10008609 130 / 2e-34 AT1G16760 417 / 3e-137 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G170901 214 / 1e-65 AT1G78940 584 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.004G170742 214 / 2e-64 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.007G001900 207 / 6e-62 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.014G001700 203 / 2e-60 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2)
Potri.018G002400 142 / 9e-39 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.006G078500 117 / 7e-30 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.018G061600 113 / 1e-28 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.006G225300 111 / 7e-28 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.001G198300 100 / 4e-24 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Potri.018G147200 93 / 8e-22 AT5G20310 162 / 1e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10035711 pacid=23147684 polypeptide=Lus10035711 locus=Lus10035711.g ID=Lus10035711.BGIv1.0 annot-version=v1.0
ATGTGGCTTGCAAAAGGGAATTCAACAAAGAGAGGAGTTAATGGAGGAGGAGGAGGAGGAGGAGGAGTTGCAGGAAATGGATTGGTAGCAGTGGCTATTG
ACAAAGATAAAGGAAGCCAAACTGCCTTGAGATGTGCTATCGAGAATCTTCACAACAAAGGTCATCCCCTCATCCTAATTCACGTTGTTCATAAATCCTC
TGGAGGATTGAATTCCGACCCTTCTCAAGCTGGAAAGTCGCATCTTGAGAACATCACCAAAAGCTTGTTCCTCACGTTTCATTGCTACTGCACCCGTAAA
GATGTGCAATGCTTCGACGTAATACTGGAAGACAACGACATCGCGAAAGCAATCGCGGAATACGTCAACTATGCAGCAATCGAGGTGTTGGTTTTGGGCG
CTCCGACTCGGCATACATTTATGAAGAAATTCAAGACCGATATACCGACGGCGGTAGCCAAAGGGGTTCCTGACTTTTGCAGAGTTTACGTCGTCTCGAA
AGGGAAGCCGACGTTGGTGAAACAGGCGTCTCGTCCGGCGCCGTTCGTGTCTCCTCTGCTGGACCAAATACAGAACCAGTTTCATTTTAATGATCATGAA
GAGGATGATACTGCTTCTCAGTTGTCTTCGAGAAGCAGAAGCATTCGGTCGGATTGGAGTGCGCCTGCCGCCAAACCTCGTGTCTCCGTCGATGATTCCT
TCAGGTACAAATATTAA
AA sequence
>Lus10035711 pacid=23147684 polypeptide=Lus10035711 locus=Lus10035711.g ID=Lus10035711.BGIv1.0 annot-version=v1.0
MWLAKGNSTKRGVNGGGGGGGGVAGNGLVAVAIDKDKGSQTALRCAIENLHNKGHPLILIHVVHKSSGGLNSDPSQAGKSHLENITKSLFLTFHCYCTRK
DVQCFDVILEDNDIAKAIAEYVNYAAIEVLVLGAPTRHTFMKKFKTDIPTAVAKGVPDFCRVYVVSKGKPTLVKQASRPAPFVSPLLDQIQNQFHFNDHE
EDDTASQLSSRSRSIRSDWSAPAAKPRVSVDDSFRYKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16760 Protein kinase protein with ad... Lus10035711 0 1

Lus10035711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.