Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43780 91 / 4e-26 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037305 [exp] 119 / 1e-37 AT2G43780 91 / 4e-26 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G096700 [exp] 95 / 8e-28 AT2G43780 82 / 1e-22 unknown protein Potri.019G096500 [exp] 95 / 8e-28 AT2G43780 82 / 1e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035718 pacid=23147414 polypeptide=Lus10035718 locus=Lus10035718.g ID=Lus10035718.BGIv1.0 annot-version=v1.0 ATGGCTGGACTCCTAGGGTTTGGAAACCTTGCTCCTAAGGCGAAGAATGTGGTAGTTGCTGGCGGGTTGTCGGCGTTTGTGTTTGGGGTGTATTTCTACA CCATGAGAGCTGTCGGAGGGACGGATGAACTTCAGGTGGCTATTGACAAGTTTGAGGACCTGAAGAAGAAGCAAGATGCTTAA
AA sequence Show only first row Show all	>Lus10035718 pacid=23147414 polypeptide=Lus10035718 locus=Lus10035718.g ID=Lus10035718.BGIv1.0 annot-version=v1.0 MAGLLGFGNLAPKAKNVVVAGGLSAFVFGVYFYTMRAVGGTDELQVAIDKFEDLKKKQDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43780			unknown protein		Lus10035718 [exp]	0	1
AT2G43780			unknown protein		Lus10037305 [exp]	1.4	0.8434
AT4G08460			Protein of unknown function (D...		Lus10024758 [exp]	4.9	0.8158
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	4.9	0.8410
AT1G26750			unknown protein		Lus10016383 [exp]	6.3	0.8206
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	6.7	0.8336
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	6.9	0.7740
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	8.7	0.8290
AT3G62810			complex 1 family protein / LVR...		Lus10021599 [exp]	9.2	0.7815
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Lus10010413 [exp]	10.8	0.7951
AT2G18400			ribosomal protein L6 family pr...		Lus10014306 [exp]	12.0	0.7934

Compare expression of checked genes

Lus10035718 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.