Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03070 62 / 8e-13 MED8 mediator subunit 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037308 [exp] 74 / 2e-17 AT2G03070 219 / 2e-66 mediator subunit 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G253100 [exp] 62 / 4e-13 AT2G03070 501 / 7e-174 mediator subunit 8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035722 pacid=23147479 polypeptide=Lus10035722 locus=Lus10035722.g ID=Lus10035722.BGIv1.0 annot-version=v1.0 ATGGACGCGGGGATGCAGCAGGATCCTTCCCAGCTTCAAAACCAGCAGCAGCAACCGCCGGTAGTAGTGGCGGAGAGGCTGAACGCGGCGCTGCAGCAGC AGCTAAATTTAGAGTCCGTCAAGATGCGAGCTATCAGCCTCCACAAAGCCATCTCCCGCATCCTCGAAGACTTCGATGCCTACTCTCGCACCAACACAAC TCCAAAATGGTTTTTTTGA
AA sequence Show only first row Show all	>Lus10035722 pacid=23147479 polypeptide=Lus10035722 locus=Lus10035722.g ID=Lus10035722.BGIv1.0 annot-version=v1.0 MDAGMQQDPSQLQNQQQQPPVVVAERLNAALQQQLNLESVKMRAISLHKAISRILEDFDAYSRTNTTPKWFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03070		MED8	mediator subunit 8 (.1)		Lus10035722 [exp]	0	1
AT1G06230		GTE4	global transcription factor gr...		Lus10017661 [exp]	1.4	0.8999
AT1G06230		GTE4	global transcription factor gr...		Lus10033623 [exp]	10.2	0.8752
AT5G47690			binding (.1.2.3)		Lus10039082 [exp]	12.6	0.8860
AT4G17330		ATG2484-1	G2484-1 protein (.1)		Lus10004730 [exp]	19.2	0.8784
AT1G64960		HEB1	hypersensitive to excess boron...		Lus10002459 [exp]	20.2	0.8575
AT1G18610			Galactose oxidase/kelch repeat...		Lus10017860 [exp]	23.6	0.8490
AT1G17210		ATILP1	ARABIDOPSIS IAP-LIKE PROTEIN, ...		Lus10023288 [exp]	24.4	0.8664
AT1G06230		GTE4	global transcription factor gr...		Lus10033624 [exp]	25.5	0.8609
AT5G16630		ATRAD4	DNA repair protein Rad4 family...		Lus10000108 [exp]	31.2	0.8395
AT5G55300		MGO1, TOP1BETA,...	TOPOISOMERASE 1, MGOUN 1, DNA ...		Lus10032573 [exp]	32.9	0.8516

Compare expression of checked genes

Lus10035722 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.