Lus10035743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037323 73 / 1e-16 AT3G18990 79 / 2e-16 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035743 pacid=23147594 polypeptide=Lus10035743 locus=Lus10035743.g ID=Lus10035743.BGIv1.0 annot-version=v1.0
ATGGCGGAACCTGAAGCTACTGATGATGATGGACGGAGAAGACCTGAAGGCTGCTTGCTTTTCGACTCCGGGACACGTCGTTTCTCCAAATTCATCTCAC
GTCAAACCCTCAACACCAGCAGGCTTTTTATTCCAAGAAGCACGGCCACCAACTCTCGGACAGTGTCACCTTCCAAGTTCCTGGTTCTTCTACCGCCTGG
AAAGTGGAGGTTTCCAGGGGAGGCTATGGCGATGGCAGACTCTGATTCCACAATGAGGGTTTCCAAAATTTCATCAATTTTCACTCATTGGCTCCTCAGT
AATATGTTGGTGATCTAA
AA sequence
>Lus10035743 pacid=23147594 polypeptide=Lus10035743 locus=Lus10035743.g ID=Lus10035743.BGIv1.0 annot-version=v1.0
MAEPEATDDDGRRRPEGCLLFDSGTRRFSKFISRQTLNTSRLFIPRSTATNSRTVSPSKFLVLLPPGKWRFPGEAMAMADSDSTMRVSKISSIFTHWLLS
NMLVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035743 0 1
Lus10002449 3.5 1.0000
AT5G13840 FZR3 FIZZY-related 3 (.1.2) Lus10002972 5.1 1.0000
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Lus10006195 6.0 1.0000
AT5G19580 glyoxal oxidase-related protei... Lus10011111 9.2 1.0000
Lus10010414 9.6 1.0000
Lus10025056 10.6 1.0000
AT2G22620 Rhamnogalacturonate lyase fami... Lus10010628 10.7 1.0000
Lus10010663 11.0 1.0000
AT1G14220 Ribonuclease T2 family protein... Lus10015409 11.5 1.0000
AT3G26140 Cellulase (glycosyl hydrolase ... Lus10032312 14.0 1.0000

Lus10035743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.