Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55915 132 / 2e-38 zinc ion binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037337 [exp] 197 / 2e-65 AT1G55915 214 / 5e-68 zinc ion binding (.1) Lus10016607 [exp] 134 / 5e-39 AT1G55915 431 / 4e-150 zinc ion binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G009700 [exp] 174 / 2e-55 AT1G55915 314 / 2e-105 zinc ion binding (.1) Potri.011G092900 [exp] 146 / 2e-43 AT1G55915 429 / 5e-149 zinc ion binding (.1) Potri.010G249400 [exp] 103 / 3e-28 AT1G55915 157 / 3e-45 zinc ion binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0126 [flax] [poplar] Peptidase_MA PF08325 [flax] [poplar] WLM WLM domain
Representative CDS sequence Show only first row Show all	>Lus10035761 pacid=23147389 polypeptide=Lus10035761 locus=Lus10035761.g ID=Lus10035761.BGIv1.0 annot-version=v1.0 ATGGATCTTAATGATCTGAACAAGGTTTGGGAAATCAAGCCACTGAAGATGATTGGAGAAGATGAGGCCAAGATAATTCTTGAAAAGATAGCAAAACAGG TGCAGCCGATCATGCGCAGGAGGAAATGGAAAGTTACATTACTCTCCGAGTTCTGCCCTTCCAATCCGTCACTTATGGGTTTGAACATTGGTGGAGGGGC AGAGGTCAAGCTTAGACTGCGGAGGGCAAACAACCAGTGGGATTTCTTCCCTTATGAACAGATTCTCGATACCATGTTGCATGAGGCTTTGCCACAATGA
AA sequence Show only first row Show all	>Lus10035761 pacid=23147389 polypeptide=Lus10035761 locus=Lus10035761.g ID=Lus10035761.BGIv1.0 annot-version=v1.0 MDLNDLNKVWEIKPLKMIGEDEAKIILEKIAKQVQPIMRRRKWKVTLLSEFCPSNPSLMGLNIGGGAEVKLRLRRANNQWDFFPYEQILDTMLHEALPQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55915			zinc ion binding (.1)		Lus10035761 [exp]	0	1
AT4G02600		MLO1, ATMLO1	MILDEW RESISTANCE LOCUS O 1, S...		Lus10001336 [exp]	29.2	0.6819
AT2G01860		EMB975	EMBRYO DEFECTIVE 975, Tetratri...		Lus10031347 [exp]	86.3	0.6917
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Lus10010289 [exp]	100.3	0.6792
AT4G36020		CSDP1	cold shock domain protein 1 (....		Lus10001724 [exp]	126.4	0.6625
AT1G17450			B-block binding subunit of TFI...		Lus10022088 [exp]	198.8	0.6379
AT2G42430	AS2	ASL18, LBD16	ASYMMETRIC LEAVES2-LIKE 18, la...		Lus10014757 [exp]	239.9	0.6423

Compare expression of checked genes

Lus10035761 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.