Plant FIBer expression Database

Lus10035777 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12244 176 / 6e-55 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G225600
[exp]
242 / 3e-81 AT1G12244 250 / 8e-84 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0580 YqgF PF03652 RuvX Holliday junction resolvase
Representative CDS sequence
>Lus10035777 pacid=23147448 polypeptide=Lus10035777 locus=Lus10035777.g ID=Lus10035777.BGIv1.0 annot-version=v1.0
ATGGGTCCATTGTGCTATAGCAATTCTCTGAGTTACCGGAATTTTCTTCCTCTGAGAGCTAATGCAATTCCAGAGACTGGTGAAAACTCCAGCATCTCTA
GAAATGTGTCATTGGTTGGCAATCACAATGACTGGAGGAAGTTAAAGGCGATTCTATCTGTGGAGGAACTTCCACCAAATGCATTCCGCCGGAAGAACGA
TCCAAAATGGAGAGGGGGGTTCAGTCTAGGAGTGGATCTCGGATTGGCTCGCACTGGTCTTGCCCTCAGCAAAGGGTTCATTGTTCGTCCTCTCACGGTG
TTGGAAATGCGAGGACAACAGCTTGAGCTACGGCTTCTTAAAATTGCAGAAGATGAGGAGGTAGATGAGTTTATAATTGGACTACCCAGATCATCTGACG
GCAAGGAGACCCCTCAGTCCAACAAAGTTCGCAGTGTTGCTGGAAGATTTGCTGCCCGGGCTGCTGAAAGGGGACTCACCATGGAAGCTCGGCAAAAGAA
AATTGACGCATATGCTGCCGTGATGGTACTAGAAAGATATTTTTCCGCGGCAGGTAATGGAACTGAGCTTGTAGTACCAAAGCAATTGGATCTACAAGAT
AAGTTAAGAAATGGTCCACCCAAGGATACCGACTTCTACCCAGCTGAGTAA
AA sequence
>Lus10035777 pacid=23147448 polypeptide=Lus10035777 locus=Lus10035777.g ID=Lus10035777.BGIv1.0 annot-version=v1.0
MGPLCYSNSLSYRNFLPLRANAIPETGENSSISRNVSLVGNHNDWRKLKAILSVEELPPNAFRRKNDPKWRGGFSLGVDLGLARTGLALSKGFIVRPLTV
LEMRGQQLELRLLKIAEDEEVDEFIIGLPRSSDGKETPQSNKVRSVAGRFAARAAERGLTMEARQKKIDAYAAVMVLERYFSAAGNGTELVVPKQLDLQD
KLRNGPPKDTDFYPAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G12244 Polynucleotidyl transferase, r... Lus10035777
[exp]
0 1
AT5G39940 FAD/NAD(P)-binding oxidoreduct... Lus10001121
[exp]
6.3 0.8532
AT3G24440 VRN5, VIL1 VERNALIZATION 5, VIN3-LIKE 1, ... Lus10019394
[exp]
8.4 0.8536
AT5G16715 EMB2247 embryo defective 2247, ATP bin... Lus10009139
[exp]
8.9 0.8770
AT3G24440 VRN5, VIL1 VERNALIZATION 5, VIN3-LIKE 1, ... Lus10043251
[exp]
9.2 0.8585
AT5G15640 Mitochondrial substrate carrie... Lus10041498
[exp]
10.5 0.8279
AT1G36320 unknown protein Lus10033109
[exp]
12.0 0.8429
AT5G63420 Trihelix EMB2746 embryo defective 2746, RNA-met... Lus10022454
[exp]
12.0 0.8620
AT4G29750 CRS1 / YhbY (CRM) domain-conta... Lus10027610
[exp]
13.3 0.8734
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10033043
[exp]
13.4 0.8430
AT5G51460 ATTPPA Haloacid dehalogenase-like hyd... Lus10027208
[exp]
13.6 0.7691

Lus10035777 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.