Lus10035780 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15352 77 / 2e-20 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
AT1G53030 70 / 1e-17 Cytochrome C oxidase copper chaperone (COX17) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037356 82 / 2e-22 AT3G15352 101 / 3e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Lus10018872 74 / 3e-19 AT3G15352 94 / 3e-27 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G400000 76 / 6e-20 AT3G15352 102 / 6e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Potri.011G119000 72 / 1e-18 AT3G15352 97 / 2e-28 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0351 CHCH PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Representative CDS sequence
>Lus10035780 pacid=23147516 polypeptide=Lus10035780 locus=Lus10035780.g ID=Lus10035780.BGIv1.0 annot-version=v1.0
ATGGGTGGGCTCGCTTTGCAGAACTCTGCCCCTGCCTCAGGTTCGTCAGGGTCACAACAGGGCGCTGAACAAGCAGTCGCGAAGCCAAAGAAGAAAATCT
GTTGTGCTTGCCCTGATACAAAGAAGCTGCGAGACGAATGCATAGTGGAGCACGGTGAATCTGCTTGTGCAAAATGGATTGAGGCGCATCGTGTTTGCCT
CCGGGCAGAGGGATTCAATGTTTGA
AA sequence
>Lus10035780 pacid=23147516 polypeptide=Lus10035780 locus=Lus10035780.g ID=Lus10035780.BGIv1.0 annot-version=v1.0
MGGLALQNSAPASGSSGSQQGAEQAVAKPKKKICCACPDTKKLRDECIVEHGESACAKWIEAHRVCLRAEGFNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15352 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROM... Lus10035780 0 1
AT1G52740 HTA9 histone H2A protein 9 (.1) Lus10043301 1.7 0.8862
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Lus10013897 4.9 0.8778
AT5G48580 FKBP15-2 FK506- and rapamycin-binding p... Lus10025889 6.0 0.8774
AT5G57000 unknown protein Lus10006884 8.7 0.8764
AT3G46020 RNA-binding (RRM/RBD/RNP motif... Lus10040854 9.5 0.8714
AT4G22310 Uncharacterised protein family... Lus10011790 18.7 0.8759
AT1G01210 DNA-directed RNA polymerase, s... Lus10005984 22.0 0.8417
AT2G43080 AT-P4H-1 P4H isoform 1 (.1) Lus10031048 26.1 0.8373
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10017822 26.8 0.8537
AT3G09890 Ankyrin repeat family protein ... Lus10014410 30.4 0.8313

Lus10035780 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.