Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77750 101 / 1e-28 Ribosomal protein S13/S18 family (.1) AT5G14320 96 / 2e-26 EMB3137 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037359 [exp] 215 / 3e-73 AT1G77750 141 / 3e-43 Ribosomal protein S13/S18 family (.1) Lus10006182 [exp] 152 / 3e-47 AT5G14320 132 / 1e-38 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2) Lus10025642 [exp] 92 / 1e-24 AT5G14320 222 / 4e-75 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2) Lus10018192 [exp] 92 / 1e-24 AT5G14320 222 / 3e-75 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G088400 [exp] 137 / 6e-42 AT1G77750 175 / 4e-56 Ribosomal protein S13/S18 family (.1) Potri.005G172600 [exp] 93 / 5e-25 AT5G14320 227 / 5e-77 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2) Potri.002G088300 [exp] 92 / 1e-24 AT5G14320 229 / 5e-78 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0303 [flax] [poplar] H2TH PF00416 [flax] [poplar] Ribosomal_S13 Ribosomal protein S13/S18
Representative CDS sequence Show only first row Show all	>Lus10035785 pacid=23147437 polypeptide=Lus10035785 locus=Lus10035785.g ID=Lus10035785.BGIv1.0 annot-version=v1.0 ATGCTTGGACTGCGAAGATCTCTTCACGATGTCAGCCAACGCCTTCTTCAGAATGTAGCGTTCCGCTGTCAACAAGTGCAATGCCTTCGTATCGGGAATG CGGAGATTCCAAATCACAAGAGGCTGGAGACTTCTCTTCAGTATATCCATGGGATTGGACGCAGCAGGGCTCATCAGATGCTAGTGGACTTGAGTATTCA GAATAAGCTTACCAAGGACTTGACTGGTGTAGAACTTAATTCTCTTAAGGAGGAGGTCTCTAGGTACTTGACTGGAGGAGATCTAGTAAGCTCTCATCTT TGCCCCCTTACTAACACCTGCCTTTCTCTTACACTAGGTTTGTCTCCCTAA
AA sequence Show only first row Show all	>Lus10035785 pacid=23147437 polypeptide=Lus10035785 locus=Lus10035785.g ID=Lus10035785.BGIv1.0 annot-version=v1.0 MLGLRRSLHDVSQRLLQNVAFRCQQVQCLRIGNAEIPNHKRLETSLQYIHGIGRSRAHQMLVDLSIQNKLTKDLTGVELNSLKEEVSRYLTGGDLVSSHL CPLTNTCLSLTLGLSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G77750			Ribosomal protein S13/S18 fami...		Lus10035785 [exp]	0	1
AT4G10550			Subtilase family protein (.1.2...		Lus10035478 [exp]	3.3	0.8568
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10010928 [exp]	3.9	0.8861
AT4G12230			alpha/beta-Hydrolases superfam...		Lus10024569 [exp]	5.9	0.8925
AT4G12230			alpha/beta-Hydrolases superfam...		Lus10032207 [exp]	7.2	0.8826
AT5G14290			Mitochondrial ribosomal protei...		Lus10041583 [exp]	7.3	0.8887
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Lus10023478 [exp]	8.1	0.8700
					Lus10005391 [exp]	12.0	0.8521
AT4G36890		IRX14	irregular xylem 14, Nucleotide...		Lus10033785 [exp]	13.0	0.8655
AT5G14290			Mitochondrial ribosomal protei...		Lus10022331 [exp]	13.4	0.8137
AT5G59440		ATTMPK.2, ATTMP...	ZEUS1, ARABIDOPSIS THALIANA TH...		Lus10027801 [exp]	14.0	0.8538

Compare expression of checked genes

Lus10035785 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.