Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29130 67 / 6e-15 GIN2, ATHXK1 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1) AT1G47840 66 / 1e-14 HXK3 hexokinase 3 (.1) AT2G19860 66 / 2e-14 ATHXK2 ARABIDOPSIS THALIANA HEXOKINASE 2, hexokinase 2 (.1.2) AT4G37840 65 / 4e-14 HKL3 hexokinase-like 3 (.1) AT3G20040 53 / 7e-10 HKL2, ATHXK4 HEXOKINASE-LIKE 2, Hexokinase (.1) AT1G50460 51 / 3e-09 ATHKL1, HKL1 hexokinase-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024336 [exp] 113 / 3e-31 AT1G47840 646 / 0.0 hexokinase 3 (.1) Lus10002041 [exp] 112 / 7e-31 AT1G47840 643 / 0.0 hexokinase 3 (.1) Lus10037367 [exp] 79 / 2e-19 AT1G47840 97 / 9e-29 hexokinase 3 (.1) Lus10038287 [exp] 69 / 2e-15 AT4G29130 734 / 0.0 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1) Lus10025815 [exp] 68 / 3e-15 AT2G19860 582 / 0.0 ARABIDOPSIS THALIANA HEXOKINASE 2, hexokinase 2 (.1.2) Lus10011584 [exp] 66 / 3e-14 AT4G37840 374 / 1e-125 hexokinase-like 3 (.1) Lus10012946 [exp] 64 / 1e-13 AT2G19860 701 / 0.0 ARABIDOPSIS THALIANA HEXOKINASE 2, hexokinase 2 (.1.2) Lus10006843 [exp] 63 / 2e-13 AT4G29130 710 / 0.0 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1) Lus10037588 [exp] 62 / 4e-13 AT4G29130 709 / 0.0 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G238600 [exp] 89 / 1e-22 AT1G47840 644 / 0.0 hexokinase 3 (.1) Potri.007G009300 [exp] 70 / 9e-16 AT4G37840 520 / 0.0 hexokinase-like 3 (.1) Potri.001G190400 [exp] 66 / 1e-14 AT4G29130 649 / 0.0 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1) Potri.018G088300 [exp] 66 / 2e-14 AT4G29130 743 / 0.0 GLUCOSE INSENSITIVE 2, ARABIDOPSIS THALIANA HEXOKINASE 1, hexokinase 1 (.1) Potri.009G050000 [exp] 55 / 1e-10 AT1G50460 576 / 0.0 hexokinase-like 1 (.1) Potri.001G254800 [exp] 50 / 5e-09 AT1G50460 620 / 0.0 hexokinase-like 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0108 [flax] [poplar] Actin_ATPase PF03727 [flax] [poplar] Hexokinase_2 Hexokinase
Representative CDS sequence Show only first row Show all	>Lus10035793 pacid=23147423 polypeptide=Lus10035793 locus=Lus10035793.g ID=Lus10035793.BGIv1.0 annot-version=v1.0 ATGTACCTAGGAGAAATTGCTCGAAGAATGCTGCTGAAGATGGCAGAAGACGGGGATCTGTTTGGCAGAGCTGTCCCTGACAAACTATCCACCACTTTCA GTTTCAGAACTCCAGATCTTTGTGGAATGCACCAGGACATTTCTGATGAACTTCAAACTGCTGGCGCTACACAGTACGTCGTTGCTGGGTGGAGTCCAAC TTGA
AA sequence Show only first row Show all	>Lus10035793 pacid=23147423 polypeptide=Lus10035793 locus=Lus10035793.g ID=Lus10035793.BGIv1.0 annot-version=v1.0 MYLGEIARRMLLKMAEDGDLFGRAVPDKLSTTFSFRTPDLCGMHQDISDELQTAGATQYVVAGWSPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47840		HXK3	hexokinase 3 (.1)		Lus10035793 [exp]	0	1
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Lus10026079 [exp]	4.6	0.9871
AT3G52610			unknown protein		Lus10022698 [exp]	6.3	0.9884
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10010759 [exp]	7.1	0.9823
AT3G23550			MATE efflux family protein (.1...		Lus10012960 [exp]	8.6	0.8898
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Lus10022427 [exp]	9.2	0.9879
AT1G08465	YABBY	YAB2	YABBY2, Plant-specific transcr...		Lus10008374 [exp]	12.6	0.9831
					Lus10011636 [exp]	16.1	0.9813
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	17.3	0.9813
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	18.5	0.9813
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Lus10016732 [exp]	19.3	0.9810

Compare expression of checked genes

Lus10035793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.