Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035797 [exp] 0 / 1 AT1G58025 162 / 1e-45 DNA-binding bromodomain-containing protein (.1.2.3) Lus10037368 [exp] 0 / 1 AT1G58025 246 / 2e-74 DNA-binding bromodomain-containing protein (.1.2.3)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035794 pacid=23147662 polypeptide=Lus10035794 locus=Lus10035794.g ID=Lus10035794.BGIv1.0 annot-version=v1.0 ATGCTTGACAGACCGCAGGCCAGTCTGCTGTTGAAGGAGTCTCCACCGAGATCAAGCAAGAGGTTTCTTCTTCTTTGCTTGTCTGTTCTTTTAAAGGGAG GATCTCCTGTGGGAGGCCCCGGTGGAGAGGATTCGTCATCAAACATAGCTGACTCACCTGCTCTAGATACCAATGCAGAGGTGGATGGAACTGCACAAGA TATTAAAATGGATGAAAGTCTCATGATGAAATGGAAGAGGAAGAGAAACAGGAGACTTCTCGAATGGAATACCGTTGACTGTGTTTGA
AA sequence Show only first row Show all	>Lus10035794 pacid=23147662 polypeptide=Lus10035794 locus=Lus10035794.g ID=Lus10035794.BGIv1.0 annot-version=v1.0 MLDRPQASLLLKESPPRSSKRFLLLCLSVLLKGGSPVGGPGGEDSSSNIADSPALDTNAEVDGTAQDIKMDESLMMKWKRKRNRRLLEWNTVDCV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035794 [exp]	0	1
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	3.9	0.6211
					Lus10028018 [exp]	5.8	0.6099
AT2G26850			F-box family protein (.1)		Lus10036444 [exp]	12.2	0.5812
AT1G70710		CEL1 ,AtGH9B1	CELLULASE 1, glycosyl hydrolas...		Lus10031139 [exp]	16.7	0.5751
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	22.2	0.5599
					Lus10034545 [exp]	24.0	0.5599
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	25.6	0.5599
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	27.2	0.5599
AT5G63180			Pectin lyase-like superfamily ...		Lus10022310 [exp]	27.3	0.5483
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	28.6	0.5599

Compare expression of checked genes

Lus10035794 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.