Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48580 129 / 5e-39 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 122 / 1e-36 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT5G48570 76 / 4e-17 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 74 / 2e-16 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT4G25340 65 / 2e-13 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT3G55520 62 / 8e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G45680 62 / 2e-12 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT5G05420 56 / 5e-11 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G12340 54 / 2e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G39710 53 / 3e-09 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025889 [exp] 156 / 3e-50 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10038215 [exp] 159 / 8e-48 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002339 [exp] 140 / 8e-44 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1) Lus10003170 [exp] 140 / 2e-43 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10003171 [exp] 75 / 1e-16 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 75 / 1e-16 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 72 / 2e-15 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 72 / 2e-15 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10015029 [exp] 71 / 3e-15 AT4G25340 331 / 8e-110 FK506 BINDING PROTEIN 53 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G248200 [exp] 137 / 1e-42 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.014G149400 [exp] 75 / 1e-16 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 73 / 5e-16 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.012G129200 [exp] 73 / 6e-16 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G248300 [exp] 72 / 8e-16 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.006G033400 [exp] 72 / 1e-15 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.010G201600 [exp] 59 / 9e-12 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.008G057900 [exp] 59 / 1e-11 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G075500 [exp] 58 / 3e-11 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.007G113100 [exp] 48 / 6e-08 AT5G64350 201 / 1e-68 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10035800 pacid=23147666 polypeptide=Lus10035800 locus=Lus10035800.g ID=Lus10035800.BGIv1.0 annot-version=v1.0 ATGGAACCTCCTCCTTGTTATTCTTTGTTCTATTTAAGATGGTCTTCAATTGCGGAAGACGATCAAGGCATTTGTATTCTCAGACTAGTTGGAAAACCAT TTAGCGTTGCTCCTGGCTGTGGTTGTCTGTTATCACTTGGCGATCCCATAGATTTTGAGCTTGGCAGTGGGCAAGTTATCAAAGGATGGGACCAAGGACT GTTGGGGATGTGCGTAGGTGAGAAGCGGAACTTGAAAATTCCTGCAAAACTTGGTTATGGCGACCAAGGCTCTCCCCCTACGATTCCAGGTGGAGCAACA TTGATATTCGATACGGAGCTTGTTGCTGTAAATGGGAAGACAAAGGGAGGAGAGACTGCAAAAGATAGTGAGCTCTAG
AA sequence Show only first row Show all	>Lus10035800 pacid=23147666 polypeptide=Lus10035800 locus=Lus10035800.g ID=Lus10035800.BGIv1.0 annot-version=v1.0 MEPPPCYSLFYLRWSSIAEDDQGICILRLVGKPFSVAPGCGCLLSLGDPIDFELGSGQVIKGWDQGLLGMCVGEKRNLKIPAKLGYGDQGSPPTIPGGAT LIFDTELVAVNGKTKGGETAKDSEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10035800 [exp]	0	1
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	2.0	0.8935
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10006716 [exp]	4.0	0.8516
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	6.5	0.8485
AT5G55640			unknown protein		Lus10043162 [exp]	8.1	0.7929
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	8.2	0.8395
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	9.8	0.8100
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	10.7	0.8145
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10017291 [exp]	11.2	0.7935
AT5G04000			unknown protein		Lus10018038 [exp]	12.0	0.8018
AT3G43810		CAM7	calmodulin 7 (.1)		Lus10022589 [exp]	13.4	0.7947

Compare expression of checked genes

Lus10035800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.