Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30660 115 / 7e-36 Low temperature and salt responsive protein family (.1.2) AT4G28088 115 / 7e-36 Low temperature and salt responsive protein family (.1) AT2G24040 110 / 1e-33 Low temperature and salt responsive protein family (.1) AT4G30650 96 / 8e-28 Low temperature and salt responsive protein family (.1) AT2G38905 66 / 2e-16 Low temperature and salt responsive protein family (.1) AT3G05880 64 / 1e-15 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 64 / 1e-15 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT1G57550 50 / 6e-10 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036592 [exp] 145 / 9e-48 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10040370 [exp] 66 / 3e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 66 / 3e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 64 / 2e-15 ND 89 / 1e-25 Lus10029450 [exp] 64 / 4e-15 ND 87 / 6e-25 Lus10005948 [exp] 63 / 2e-14 ND 85 / 5e-23 Lus10019890 [exp] 59 / 1e-13 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 59 / 1e-13 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G182500 [exp] 127 / 1e-40 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 109 / 2e-33 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 67 / 9e-17 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 66 / 3e-16 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 65 / 7e-16 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 62 / 7e-15 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 62 / 1e-14 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10035809 pacid=23147501 polypeptide=Lus10035809 locus=Lus10035809.g ID=Lus10035809.BGIv1.0 annot-version=v1.0 ATGCCGAGCAGATGTGCCATCTTCTGCGAGATCCTCATCGCAATCTTGCTCCCTCCTCTGGGAGTCTGCCTCAGGCATGGCTGCTGTACCGTGGAGTTCT GCATCTGCGTGCTGCTGACGATTCTCGGATACCTTCCTGGAATAATCTATGCGCTCTATGCGATTGTGTTCGTCGATCGTGACGAGTTCTTCGACGAGTC TAGGCGTCCTCTCTATTCCTCTTACTAG
AA sequence Show only first row Show all	>Lus10035809 pacid=23147501 polypeptide=Lus10035809 locus=Lus10035809.g ID=Lus10035809.BGIv1.0 annot-version=v1.0 MPSRCAIFCEILIAILLPPLGVCLRHGCCTVEFCICVLLTILGYLPGIIYALYAIVFVDRDEFFDESRRPLYSSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30660			Low temperature and salt respo...		Lus10035809 [exp]	0	1
AT1G19130			unknown protein		Lus10039920 [exp]	3.0	0.8259
AT1G76200			unknown protein		Lus10034571 [exp]	8.5	0.8023
AT2G01080			Late embryogenesis abundant (L...		Lus10036163 [exp]	16.3	0.7584
AT2G26170		CYP711A1, MAX1	MORE AXILLARY BRANCHES 1, "cyt...		Lus10008098 [exp]	16.7	0.7187
AT5G50460			secE/sec61-gamma protein trans...		Lus10041552 [exp]	17.0	0.7821
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Lus10025967 [exp]	19.7	0.7605
AT5G19740			Peptidase M28 family protein (...		Lus10011133 [exp]	21.5	0.7706
AT3G03490		AtPEX19-1, PEX1...	peroxin 19-1 (.1)		Lus10010463 [exp]	21.6	0.7591
AT5G25280			serine-rich protein-related (....		Lus10039998 [exp]	22.9	0.7507
AT1G74940			Protein of unknown function (D...		Lus10027642 [exp]	27.2	0.7756

Compare expression of checked genes

Lus10035809 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.