Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24050 229 / 1e-71 eIFiso4G2 eukaryotic translation Initiation Factor isoform 4G2, MIF4G domain-containing protein / MA3 domain-containing protein (.1) AT5G57870 224 / 2e-69 eIFiso4G1 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) AT4G30680 210 / 4e-69 Initiation factor eIF-4 gamma, MA3 (.1) AT4G24800 66 / 8e-13 ECIP1 EIN2 C-terminus Interacting Protein 1, MA3 domain-containing protein (.1.2.3) AT5G63190 64 / 3e-12 MA3 domain-containing protein (.1.2) AT3G48390 61 / 2e-11 MA3 domain-containing protein (.1) AT1G22730 53 / 2e-08 MA3 domain-containing protein (.1) AT3G60240 48 / 1e-06 CUM2, EIF4G CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036594 [exp] 340 / 2e-114 AT5G57870 625 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Lus10010782 [exp] 289 / 3e-94 AT5G57870 952 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Lus10022168 [exp] 286 / 1e-92 AT5G57870 976 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Lus10028156 [exp] 59 / 2e-10 AT3G60240 1275 / 0.0 CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4) Lus10042856 [exp] 57 / 8e-10 AT3G60240 970 / 0.0 CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4) Lus10012205 [exp] 54 / 1e-08 AT1G22730 560 / 0.0 MA3 domain-containing protein (.1) Lus10011324 [exp] 53 / 2e-08 AT1G22730 816 / 0.0 MA3 domain-containing protein (.1) Lus10018085 [exp] 52 / 4e-08 AT4G24800 995 / 0.0 EIN2 C-terminus Interacting Protein 1, MA3 domain-containing protein (.1.2.3) Lus10042080 [exp] 49 / 4e-07 AT4G24800 974 / 0.0 EIN2 C-terminus Interacting Protein 1, MA3 domain-containing protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G104100 [exp] 261 / 3e-83 AT5G57870 882 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Potri.006G182100 [exp] 255 / 5e-81 AT5G57870 884 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Potri.006G265300 [exp] 224 / 8e-70 AT5G57870 790 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Potri.018G017600 [exp] 221 / 2e-68 AT5G57870 809 / 0.0 eukaryotic translation Initiation Factor isoform 4G1, MIF4G domain-containing protein / MA3 domain-containing protein (.1.2) Potri.012G091900 [exp] 59 / 2e-10 AT5G63190 1022 / 0.0 MA3 domain-containing protein (.1.2) Potri.015G088300 [exp] 57 / 5e-10 AT4G24800 1008 / 0.0 EIN2 C-terminus Interacting Protein 1, MA3 domain-containing protein (.1.2.3) Potri.014G052600 [exp] 57 / 7e-10 AT3G60240 998 / 0.0 CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4) Potri.005G199200 [exp] 54 / 8e-09 AT1G22730 828 / 0.0 MA3 domain-containing protein (.1) Potri.002G140200 [exp] 52 / 4e-08 AT3G60240 942 / 0.0 CUCUMOVIRUS MULTIPLICATION 2, eukaryotic translation initiation factor 4G (.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF02847 [flax] [poplar] MA3 MA3 domain
Representative CDS sequence Show only first row Show all	>Lus10035812 pacid=23147417 polypeptide=Lus10035812 locus=Lus10035812.g ID=Lus10035812.BGIv1.0 annot-version=v1.0 ATGAATGCCGATGAACTCAAGAGGAAAACGGTCTCAATCTTGAAGGAGTATTTCAGCATTCGACTTGTGGACGAAGCATTCCAGTGCATTGAAGAACTCA AGTCTCCAGCATACCACCCGGAAGTCATCAAGGAAGGCATTGCCCTTGGCCTGGAGGAAAACCCTCCTTGCGTGGAACCTGTCTTCAAGCTCCTCGAATA CTTGTCAACCAAGAAAACTCTCACAGCTCGAGACATAACGACCGGGTGTATGCTCTACGCAACGATGCTGGATGACATTGGAATCGACTTGCCCAGAGCG CCCAACAACTTTGGCGAGATCATCGGGAAACTAATCCTCTCTGGTCTACTGGAGTTCAAATCGGTGACGGAGATCCTAAAGAAGATGGAGGACGACATGT ACCAGAAATCCGTGCTGGATGCAGCAGTCAGGATTGTGAAATCCAGCTCCGTAGGCCAAGGTATACTTGAATCCCAAGCTGCTGATATCGAGGCTTGCCA GAGCTTGTTCCAGTAA
AA sequence Show only first row Show all	>Lus10035812 pacid=23147417 polypeptide=Lus10035812 locus=Lus10035812.g ID=Lus10035812.BGIv1.0 annot-version=v1.0 MNADELKRKTVSILKEYFSIRLVDEAFQCIEELKSPAYHPEVIKEGIALGLEENPPCVEPVFKLLEYLSTKKTLTARDITTGCMLYATMLDDIGIDLPRA PNNFGEIIGKLILSGLLEFKSVTEILKKMEDDMYQKSVLDAAVRIVKSSSVGQGILESQAADIEACQSLFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24050		eIFiso4G2	eukaryotic translation Initiat...		Lus10035812 [exp]	0	1
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10017293 [exp]	4.1	0.7131
AT1G80860		ATPLMT	ARABIDOPSIS PHOSPHOLIPID N-MET...		Lus10026087 [exp]	9.5	0.7116
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	12.1	0.7120
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	14.3	0.6947
AT3G58660			Ribosomal protein L1p/L10e fam...		Lus10024134 [exp]	18.8	0.6952
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10029320 [exp]	19.5	0.7065
AT3G22660			rRNA processing protein-relate...		Lus10031698 [exp]	20.8	0.6903
AT4G17520			Hyaluronan / mRNA binding fami...		Lus10000599 [exp]	21.5	0.6835
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	22.0	0.6936
AT1G71730			unknown protein		Lus10029741 [exp]	27.9	0.6609

Compare expression of checked genes

Lus10035812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.