Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 174 / 2e-58 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 150 / 6e-49 Dynein light chain type 1 family protein (.1) AT4G27360 107 / 7e-32 Dynein light chain type 1 family protein (.1) AT5G20110 79 / 1e-19 Dynein light chain type 1 family protein (.1) AT1G23220 77 / 1e-19 Dynein light chain type 1 family protein (.1) AT4G15930 76 / 2e-19 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025794 [exp] 186 / 3e-63 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 170 / 1e-56 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 159 / 4e-52 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 111 / 3e-33 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 110 / 7e-33 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 103 / 6e-30 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 82 / 1e-21 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 78 / 8e-20 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 76 / 4e-18 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G052800 [exp] 177 / 1e-59 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 111 / 2e-33 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 108 / 5e-32 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 104 / 2e-30 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 98 / 5e-28 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 81 / 3e-21 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 81 / 4e-21 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 80 / 2e-20 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G401400 [exp] 77 / 5e-19 AT1G23220 109 / 2e-31 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 74 / 2e-18 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10035868 pacid=23141140 polypeptide=Lus10035868 locus=Lus10035868.g ID=Lus10035868.BGIv1.0 annot-version=v1.0 ATGTTGGAAGGGAAAGCGGTGGTCAATGATACAGATATGCCAGTGAAGATGCAGATGCAAGCCATGTCTTATGCCTCTGAAGCTTTAGATCATTATGACG TCCTTGACTGCAAATCCATTGCAGGCCACATCAAGAAGGAGTTCGACATGAGATATGGAGGCGGATGGCAATGTGTGGTCGGTTCGAACTTCGGTTGCTT CTTCACTCACTCTAAAGGAACTTTCATTTACTTCACAGTGGAAACTCTCAAATTTCTCATCTTCAAAGGAGCTTCTTCTCCCTGA
AA sequence Show only first row Show all	>Lus10035868 pacid=23141140 polypeptide=Lus10035868 locus=Lus10035868.g ID=Lus10035868.BGIv1.0 annot-version=v1.0 MLEGKAVVNDTDMPVKMQMQAMSYASEALDHYDVLDCKSIAGHIKKEFDMRYGGGWQCVVGSNFGCFFTHSKGTFIYFTVETLKFLIFKGASSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10035868 [exp]	0	1
AT1G73830	bHLH	bHLH050, BEE3	BR enhanced expression 3 (.1.2...		Lus10009673 [exp]	1.4	0.8311
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10029049 [exp]	3.3	0.8443
AT1G60010			unknown protein		Lus10030651 [exp]	8.7	0.8024
AT5G03730		AtCTR1, SIS1, C...	SUGAR-INSENSITIVE 1, CONSTITUT...		Lus10043428 [exp]	9.2	0.7960
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10025794 [exp]	9.4	0.7696
AT2G02980		OTP85	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10021667 [exp]	16.4	0.8277
AT1G18010			Major facilitator superfamily ...		Lus10019528 [exp]	20.1	0.7636
AT1G60420			DC1 domain-containing protein ...		Lus10029148 [exp]	30.2	0.7638
AT1G57790			F-box family protein (.1)		Lus10022706 [exp]	30.3	0.7999
AT3G51940			unknown protein		Lus10039572 [exp]	56.8	0.7782

Compare expression of checked genes

Lus10035868 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.