Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52300 163 / 9e-53 Zinc-binding ribosomal protein family protein (.1) AT1G15250 162 / 2e-52 Zinc-binding ribosomal protein family protein (.1) AT3G16080 160 / 1e-51 Zinc-binding ribosomal protein family protein (.1) AT4G00960 65 / 2e-12 Protein kinase superfamily protein (.1) AT4G00970 64 / 3e-12 CRK41 cysteine-rich RLK (RECEPTOR-like protein kinase) 41 (.1) AT4G23290 62 / 2e-11 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT4G03230 61 / 5e-11 S-locus lectin protein kinase family protein (.1) AT1G11300 61 / 6e-11 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT4G21230 60 / 8e-11 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1) AT4G23150 60 / 1e-10 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011446 [exp] 189 / 1e-62 AT3G16080 162 / 1e-53 Zinc-binding ribosomal protein family protein (.1) Lus10037549 [exp] 187 / 6e-62 AT3G16080 160 / 8e-53 Zinc-binding ribosomal protein family protein (.1) Lus10025774 [exp] 121 / 6e-32 AT3G16030 390 / 2e-123 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10025784 [exp] 117 / 1e-30 AT3G16030 596 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10009583 [exp] 64 / 8e-13 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015093 [exp] 61 / 7e-12 AT4G23160 147 / 1e-41 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10007632 [exp] 62 / 2e-11 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018378 [exp] 60 / 2e-11 AT4G23180 180 / 1e-53 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10031579 [exp] 62 / 3e-11 AT4G23160 477 / 8e-154 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G036900 [exp] 181 / 1e-59 AT1G15250 167 / 1e-55 Zinc-binding ribosomal protein family protein (.1) Potri.003G053100 [exp] 176 / 9e-58 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.001G183200 [exp] 174 / 4e-57 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.006G243300 [exp] 174 / 7e-57 AT1G15250 170 / 1e-56 Zinc-binding ribosomal protein family protein (.1) Potri.011G035850 [exp] 65 / 1e-12 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.018G111751 [exp] 64 / 1e-12 AT4G23290 255 / 2e-81 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) Potri.011G036400 [exp] 65 / 2e-12 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G028400 [exp] 63 / 2e-12 AT4G23140 206 / 3e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.004G028532 [exp] 63 / 2e-12 AT4G23140 205 / 9e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) Potri.013G150900 [exp] 64 / 3e-12 AT4G21390 635 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01907 [flax] [poplar] Ribosomal_L37e Ribosomal protein L37e
Representative CDS sequence Show only first row Show all	>Lus10035878 pacid=23140991 polypeptide=Lus10035878 locus=Lus10035878.g ID=Lus10035878.BGIv1.0 annot-version=v1.0 ATGAGCTTGGGCATGGGTAGTAGAAGTAGTAGTGGTAGTCATCATGAGGCAAAGTGCATCCACATAGGTCTGTTATGTGTGCAGGAGAATCCAAGGGACA GACCCTCAATGCTAGAAATCACCTCCATGTTGAATAACAACAATGAAACTGCCCAATTGCCTTCCCCGAATCAGCCTGCATTTTACTACAGGGTGAACTT GCGTGATGAAGCTCAGATTATTGAAGAGGCAGAGGCTGAGGGGAGTCATCATACACTGAACCAGGGTAAGGGAACAGGGAGTTTCGGTAAGAGGAGGAAC AAGACTCACACGCTATGTGTCAGGTGCGGCCGTCGCAGCTTCCATCTCCAGAAGAGTCGCTGCTCCGCTTGTGCTTACCCGGCTGCCCGTGTCAGAAAAT ATAACTGGAGTGAGAAGGCCATCCGTAGGAAGACAACTGGAACAGGAAGGATGAGGTACATGCGCCATCTTCCTCGCAGGTTCAAGAGTGGTTTCAGAGA AGGTACCCAAGCGGCACCGAGGACCAAGGGAACTGCTGCTGCATCCACTTAG
AA sequence Show only first row Show all	>Lus10035878 pacid=23140991 polypeptide=Lus10035878 locus=Lus10035878.g ID=Lus10035878.BGIv1.0 annot-version=v1.0 MSLGMGSRSSSGSHHEAKCIHIGLLCVQENPRDRPSMLEITSMLNNNNETAQLPSPNQPAFYYRVNLRDEAQIIEEAEAEGSHHTLNQGKGTGSFGKRRN KTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAIRRKTTGTGRMRYMRHLPRRFKSGFREGTQAAPRTKGTAAAST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16080			Zinc-binding ribosomal protein...		Lus10035878 [exp]	0	1
AT4G36130			Ribosomal protein L2 family (....		Lus10028468 [exp]	3.0	0.9425
AT2G09990			Ribosomal protein S5 domain 2-...		Lus10031970 [exp]	3.3	0.8919
AT3G11250			Ribosomal protein L10 family p...		Lus10014841 [exp]	3.5	0.9370
AT5G48760			Ribosomal protein L13 family p...		Lus10016679 [exp]	6.0	0.9210
AT1G23290		RPL27A, RPL27AB	RIBOSOMAL PROTEIN L27A, Riboso...		Lus10026698 [exp]	6.0	0.9106
AT4G11630			Ribosomal protein L19 family p...		Lus10017958 [exp]	8.7	0.8883
AT5G58420			Ribosomal protein S4 (RPS4A) f...		Lus10004272 [exp]	9.2	0.9181
AT1G29900		VEN3, CARB	VENOSA 3, carbamoyl phosphate ...		Lus10021430 [exp]	10.5	0.8940
AT1G18080		RACK1A_AT, ATAR...	RECEPTOR FOR ACTIVATED C KINAS...		Lus10017569 [exp]	11.0	0.9006
AT3G57490			Ribosomal protein S5 family pr...		Lus10014909 [exp]	11.0	0.9119

Compare expression of checked genes

Lus10035878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.