Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67520 63 / 6e-13 lectin protein kinase family protein (.1) AT3G16030 54 / 8e-10 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) AT1G11330 49 / 8e-08 S-locus lectin protein kinase family protein (.1.2) AT1G11300 48 / 1e-07 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G61400 45 / 9e-07 S-locus lectin protein kinase family protein (.1) AT4G03230 45 / 1e-06 S-locus lectin protein kinase family protein (.1) AT1G61480 42 / 2e-05 S-locus lectin protein kinase family protein (.1) AT1G61610 42 / 2e-05 S-locus lectin protein kinase family protein (.1) AT1G61390 41 / 3e-05 S-locus lectin protein kinase family protein (.1.2) AT1G61440 41 / 4e-05 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025784 [exp] 122 / 1e-33 AT3G16030 596 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10025774 [exp] 102 / 2e-26 AT3G16030 390 / 2e-123 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10003156 [exp] 52 / 7e-09 AT3G16030 556 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10003420 [exp] 47 / 8e-08 AT3G12000 74 / 1e-16 S-locus related protein SLR1, putative (S1) (.1) Lus10020052 [exp] 47 / 2e-07 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006746 [exp] 44 / 3e-06 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013245 [exp] 43 / 7e-06 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10038552 [exp] 42 / 2e-05 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014723 [exp] 41 / 4e-05 AT1G11340 255 / 7e-79 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G039400 [exp] 54 / 2e-09 AT1G11330 822 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039200 [exp] 52 / 6e-09 AT1G11330 864 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.001G441400 [exp] 52 / 7e-09 AT3G16030 523 / 1e-174 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.011G038000 [exp] 51 / 9e-09 AT1G11330 810 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038401 [exp] 50 / 2e-08 AT1G11330 826 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G039100 [exp] 50 / 2e-08 AT1G11330 859 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.001G413800 [exp] 50 / 3e-08 AT4G27290 991 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119900 [exp] 50 / 3e-08 AT4G03230 974 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G039300 [exp] 50 / 3e-08 AT1G11330 829 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G038100 [exp] 49 / 4e-08 AT1G11300 175 / 2e-50 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [flax] [poplar] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Lus10035879 pacid=23140989 polypeptide=Lus10035879 locus=Lus10035879.g ID=Lus10035879.BGIv1.0 annot-version=v1.0 ATGGCCCGCACAATATGGCCGGTCTGGGTGGGCAACAGAAACCCCCCACTCAACGATAAAACAGGGTATCTGGTGATTGGAAGCGACGGGAATTTGAAGG TCGTAAATGTTGGAGGCGATCGAATTGCTGATGTGAGTCGAGCGGTGGTTTCAAGCCCAACGACTGCTGGTTTGATGGATTCTGGAAATTTGGTGCCGCA GGAACTGAATCCTAACGGGACAGTGAAGCGGGAGGTGTGTGTTGGAAATATGCACCTAGGGTTCGACTTTGATGTGATGGCAGCATTATGGACTTGA
AA sequence Show only first row Show all	>Lus10035879 pacid=23140989 polypeptide=Lus10035879 locus=Lus10035879.g ID=Lus10035879.BGIv1.0 annot-version=v1.0 MARTIWPVWVGNRNPPLNDKTGYLVIGSDGNLKVVNVGGDRIADVSRAVVSSPTTAGLMDSGNLVPQELNPNGTVKREVCVGNMHLGFDFDVMAALWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67520			lectin protein kinase family p...		Lus10035879 [exp]	0	1
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Lus10003012 [exp]	6.0	0.9060
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Lus10035782 [exp]	10.5	0.9059
AT5G45650			subtilase family protein (.1)		Lus10026062 [exp]	11.2	0.9052
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	13.4	0.9020
					Lus10021782 [exp]	15.0	0.9020
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10031542 [exp]	16.4	0.9020
AT2G25470		AtRLP21	receptor like protein 21 (.1)		Lus10027855 [exp]	17.7	0.9020
AT3G19540			Protein of unknown function (D...		Lus10028040 [exp]	19.0	0.9020
AT1G48120			hydrolases;protein serine/thre...		Lus10015869 [exp]	20.1	0.9020
AT1G17930			Aminotransferase-like, plant m...		Lus10016922 [exp]	21.2	0.9020

Compare expression of checked genes

Lus10035879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.