Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62020 141 / 1e-40 Coatomer, alpha subunit (.1) AT2G21390 141 / 1e-40 Coatomer, alpha subunit (.1) AT1G79990 62 / 6e-13 structural molecules (.1.2.3.4.5) AT3G15980 58 / 2e-11 Coatomer, beta' subunit (.1.2.3.4.5) AT1G52360 54 / 6e-10 Coatomer, beta' subunit (.1.2) AT1G11160 44 / 3e-06 Transducin/WD40 repeat-like superfamily protein (.1) AT1G61210 43 / 4e-06 DWA3 DWD hypersensitive to ABA 3, Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G11110 43 / 6e-06 SPA2 SPA1-related 2 (.1) AT5G08390 42 / 1e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT5G23430 41 / 2e-05 Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025780 [exp] 149 / 3e-43 AT2G21390 1521 / 0.0 Coatomer, alpha subunit (.1) Lus10040752 [exp] 146 / 3e-42 AT1G62020 2133 / 0.0 Coatomer, alpha subunit (.1) Lus10016481 [exp] 146 / 3e-42 AT1G62020 2130 / 0.0 Coatomer, alpha subunit (.1) Lus10011454 [exp] 142 / 9e-41 AT1G62020 2098 / 0.0 Coatomer, alpha subunit (.1) Lus10037538 [exp] 141 / 1e-40 AT2G21390 1402 / 0.0 Coatomer, alpha subunit (.1) Lus10033092 [exp] 59 / 2e-11 AT1G52360 1481 / 0.0 Coatomer, beta' subunit (.1.2) Lus10026094 [exp] 58 / 2e-11 AT3G15980 406 / 1e-135 Coatomer, beta' subunit (.1.2.3.4.5) Lus10002324 [exp] 57 / 6e-11 AT3G15980 397 / 7e-132 Coatomer, beta' subunit (.1.2.3.4.5) Lus10037525 [exp] 56 / 1e-10 AT1G52360 513 / 3e-176 Coatomer, beta' subunit (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G069700 [exp] 146 / 3e-42 AT1G62020 2100 / 0.0 Coatomer, alpha subunit (.1) Potri.012G074800 [exp] 145 / 3e-42 AT1G62020 2113 / 0.0 Coatomer, alpha subunit (.1) Potri.006G250200 [exp] 58 / 3e-11 AT1G52360 466 / 3e-157 Coatomer, beta' subunit (.1.2) Potri.001G179200 [exp] 54 / 6e-10 AT1G52360 1618 / 0.0 Coatomer, beta' subunit (.1.2) Potri.003G056300 [exp] 54 / 6e-10 AT1G52360 1653 / 0.0 Coatomer, beta' subunit (.1.2) Potri.014G095300 [exp] 42 / 9e-06 AT2G46340 846 / 0.0 SUPPRESSOR OF PHYA-105 1, SPA (suppressor of phyA-105) protein family (.1) Potri.010G255400 [exp] 40 / 3e-05 AT5G08390 927 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.008G002300 [exp] 40 / 4e-05 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.018G014367 [exp] 38 / 4e-05 AT3G15980 71 / 3e-16 Coatomer, beta' subunit (.1.2.3.4.5) Potri.006G106600 [exp] 40 / 6e-05 AT3G08850 1968 / 0.0 HEAT repeat ;WD domain, G-beta repeat protein protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10035884 pacid=23141251 polypeptide=Lus10035884 locus=Lus10035884.g ID=Lus10035884.BGIv1.0 annot-version=v1.0 ATGCTTACGAAATTTGAGACCAAGAGTAATAGAGTTAAGGGACTGAGTTTCCATAGCAAGAGGCCATGGATCTTAGCCAGTCTTCACAGTGGTGTGATCC AGCTATGGGACTACCGAATGGGGACACTAATTGACCGGTTTGATGAGCATGATGGACCAGTCCGAGGAGTTGATTTCCACAAATCTCAGCCTCTCTTTGT CTCCGGAGGTAGTCTTTTCGTTTCTGTTAAACTCGTTACATTTGGCGTCTCAAGTTATTGCTAA
AA sequence Show only first row Show all	>Lus10035884 pacid=23141251 polypeptide=Lus10035884 locus=Lus10035884.g ID=Lus10035884.BGIv1.0 annot-version=v1.0 MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFHKSQPLFVSGGSLFVSVKLVTFGVSSYC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21390			Coatomer, alpha subunit (.1)		Lus10035884 [exp]	0	1
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	1.4	0.9774
AT2G45540			WD-40 repeat family protein / ...		Lus10009307 [exp]	2.8	0.9750
AT2G45540			WD-40 repeat family protein / ...		Lus10015857 [exp]	4.9	0.9661
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	5.2	0.9720
AT2G35630		GEM1, MOR1	MICROTUBULE ORGANIZATION 1, AR...		Lus10001216 [exp]	6.3	0.9657
AT3G60920			unknown protein		Lus10009306 [exp]	6.5	0.9646
AT4G03550		ATGSL5, PMR4, G...	POWDERY MILDEW RESISTANT 4, gl...		Lus10033689 [exp]	7.9	0.9422
AT4G38200			SEC7-like guanine nucleotide e...		Lus10015863 [exp]	7.9	0.9618
AT5G27970			ARM repeat superfamily protein...		Lus10004117 [exp]	8.1	0.9647
AT5G23110			Zinc finger, C3HC4 type (RING ...		Lus10001530 [exp]	8.9	0.9609

Compare expression of checked genes

Lus10035884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.