Lus10035885 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79910 222 / 1e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 159 / 3e-44 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 155 / 2e-40 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 130 / 1e-32 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 117 / 3e-29 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT1G34220 120 / 5e-29 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 116 / 4e-28 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 100 / 7e-22 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 99 / 1e-21 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 86 / 6e-18 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025779 707 / 0 AT1G79910 199 / 8e-59 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025932 464 / 5e-156 AT5G48840 440 / 2e-149 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10011455 292 / 5e-95 AT1G79910 233 / 1e-73 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10037536 249 / 5e-78 AT1G79910 191 / 2e-57 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10038167 241 / 2e-72 AT5G48840 447 / 7e-155 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10034905 186 / 1e-51 AT4G32350 256 / 3e-75 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10023635 185 / 2e-51 AT4G32350 252 / 9e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 126 / 3e-31 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10006061 124 / 2e-30 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G181300 325 / 3e-105 AT1G79910 244 / 1e-75 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054500 323 / 6e-105 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054700 253 / 2e-78 AT1G79910 141 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054601 244 / 4e-75 AT1G79910 140 / 3e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.018G079500 182 / 1e-50 AT4G32350 240 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G117100 128 / 1e-31 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 127 / 2e-31 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.008G121300 120 / 2e-30 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.019G087400 121 / 3e-29 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.006G149800 118 / 7e-28 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10035885 pacid=23141198 polypeptide=Lus10035885 locus=Lus10035885.g ID=Lus10035885.BGIv1.0 annot-version=v1.0
ATGTTTGATAGCTTGACCAAGTCCAAATTCTACACAAAATGCAAGTCATTGATAAAGATGACCAAGGCGAGGCTGGAAGCGTCCAAGAAGAAGAAGAATG
TTGTGGCCAATTACCTTAAGAATGATATCGCTGACCTTCTCAGGGCTGGCTTTGATTCCAATGCTTATAGCAGGACTCAAGAGCTCATATTCGATCATAA
CTTGATTGCTGCTTACAAGTTTCTGGAAGATTTTTGTGACTGCATTTCCACAAATCTTGCTCTCTTGGACAAACGAAAGGAATGCCCCAAGGAATGCAGA
GAAGCCATACATTCTCTGATGTATGCTGCAGCGAGATTGGCTGAATTTCCAGAACTTCGCGATCTTCGATCCCTTTTCGCTCATAGATATGGTGATTGCG
TTGAATTGTATATTAACAAGGAGTTTGGTGAGTTGCTGAATCGAAGGCTTGCAACCAAGGAGATGAAGCTTCAGCTACTTGGTGATGTGGCTCAAGAATT
CTCCATCAACTGGGATCCCAAATCCTTGGAGCAAAAACCCTTTAAACCTCCCCATTCCATCCAGCAGCAGAACCAGAACAGAAATGAGGGATCTAACAAT
CCTGAAGATGGTGACCATAAAAGAATGAAGAGCAAAGATGATGTTGTTGCTCTAAGTAGTAAACACAACAGATTCAATAAGTATGGTAAAAGGGAAAGCC
ACAGTACATCATCAACTGAGAACTTGTTGGGGAGAAGTACTGAAGCAGAAGTTGCTGCATCACCAAGAAGGAAGAATAATGTAAGTGATGAAAACCACAG
GCTTCAAAGCAGCAGCGGGAGTGCTGAGAGCACCGATCGAGATAGTTCGCAACCTAGTCCGAGCTCAATGGGAACTACTAGTACTAGTACTGCTTCAAAG
GATGAAGTGGACAGCATCAAGATCCCCTATAGGTTTCTACCTCCGCCCTATGTCAGAACAAGGCTGGACAAGCAGGATGTGAAGGACCAAAGTTCTTCGA
ATTCGAGCTCTCCTGATACTGCTGAATCTTCCAGTGAATCACAACCAAAGCCAGGATCGGTAAGAAGAAGGCAACAAATGAAGGTAGTGGTGGGTGATGA
GATTAGTCCATTGAAGCCAGCTCCAGGCCGTGCATATTTTGGCAGTTTTGATGCAGAGATATGGAAAGCATCTGATGATGATGAAGAAGGGGAAGATGAA
GAGCTGAAAGGCAAGAAGAGCGCACAATATGAAAGGCCCATCGTGAGAAGTTATAAGCTGAAACCTCTGTCATGGAAATCAAGAGATCATGATGAGAGTG
GTAAGGAAGAATTGGTCACTGGATCAGCACTACCTTTTGGTTCCCTAGGCAAGACTAGTGCAGCCATCATAACAAGGCATGGTAGGTCTCTATCAGCAGA
GTCGAAAGTGTCGTCTGGACATGTGCATCCTAACCTACCGGATTATGATTCATTGGCTGCTAGGGTTGCAGCTTTCCTGGGTAAATGA
AA sequence
>Lus10035885 pacid=23141198 polypeptide=Lus10035885 locus=Lus10035885.g ID=Lus10035885.BGIv1.0 annot-version=v1.0
MFDSLTKSKFYTKCKSLIKMTKARLEASKKKKNVVANYLKNDIADLLRAGFDSNAYSRTQELIFDHNLIAAYKFLEDFCDCISTNLALLDKRKECPKECR
EAIHSLMYAAARLAEFPELRDLRSLFAHRYGDCVELYINKEFGELLNRRLATKEMKLQLLGDVAQEFSINWDPKSLEQKPFKPPHSIQQQNQNRNEGSNN
PEDGDHKRMKSKDDVVALSSKHNRFNKYGKRESHSTSSTENLLGRSTEAEVAASPRRKNNVSDENHRLQSSSGSAESTDRDSSQPSPSSMGTTSTSTASK
DEVDSIKIPYRFLPPPYVRTRLDKQDVKDQSSSNSSSPDTAESSSESQPKPGSVRRRQQMKVVVGDEISPLKPAPGRAYFGSFDAEIWKASDDDEEGEDE
ELKGKKSAQYERPIVRSYKLKPLSWKSRDHDESGKEELVTGSALPFGSLGKTSAAIITRHGRSLSAESKVSSGHVHPNLPDYDSLAARVAAFLGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79910 Regulator of Vps4 activity in ... Lus10035885 0 1
AT3G57120 Protein kinase superfamily pro... Lus10011518 1.0 0.9192
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10003513 4.0 0.8839
AT5G55560 Protein kinase superfamily pro... Lus10016594 4.0 0.8913
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10002953 8.4 0.8639
AT5G28840 GME "GDP-D-mannose 3',5'-epimerase... Lus10020247 12.0 0.8573
Lus10025225 14.3 0.8825
AT5G39020 Malectin/receptor-like protein... Lus10025545 14.4 0.8874
AT1G69260 AFP1 ABI five binding protein (.1) Lus10036898 18.5 0.8480
AT4G08500 ARAKIN, ATMEKK1... MAPK/ERK kinase kinase 1 (.1) Lus10042750 18.7 0.8640
AT5G53110 RING/U-box superfamily protein... Lus10007845 20.0 0.8709

Lus10035885 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.