Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52343 57 / 2e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025776 [exp] 128 / 8e-39 AT1G52343 112 / 1e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G055200 [exp] 57 / 1e-11 AT1G52343 96 / 2e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035888 pacid=23141223 polypeptide=Lus10035888 locus=Lus10035888.g ID=Lus10035888.BGIv1.0 annot-version=v1.0 ATGGTTCAGGGGAAAGGAACGGTAGTGGAGGATGGTGGGAAAGAAGATAAAGCAGCGGAGGATAAGAACTGGAGGGATGCGTTTATGGTGTTGGAGAGAG GTCTTACTGCTTACCAAGCTATCAGGACCATGTTCATCGACTGCAGCATTTACTTTGTTCTTGTCATTTCTGGCCTCTCTTTGGCATCATCCAAATCATG A
AA sequence Show only first row Show all	>Lus10035888 pacid=23141223 polypeptide=Lus10035888 locus=Lus10035888.g ID=Lus10035888.BGIv1.0 annot-version=v1.0 MVQGKGTVVEDGGKEDKAAEDKNWRDAFMVLERGLTAYQAIRTMFIDCSIYFVLVISGLSLASSKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52343			unknown protein		Lus10035888 [exp]	0	1
AT1G13340			Regulator of Vps4 activity in ...		Lus10034303 [exp]	3.0	0.7647
AT1G13340			Regulator of Vps4 activity in ...		Lus10041468 [exp]	4.5	0.7585
AT1G62280		SLAH1	SLAC1 homologue 1 (.1)		Lus10031545 [exp]	6.6	0.7434
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10032014 [exp]	15.3	0.7159
AT1G13810			Restriction endonuclease, type...		Lus10017632 [exp]	21.5	0.6827
AT5G54855			Pollen Ole e 1 allergen and ex...		Lus10019622 [exp]	21.8	0.6985
AT4G19510			Disease resistance protein (TI...		Lus10024149 [exp]	22.8	0.6481
AT1G71870			MATE efflux family protein (.1...		Lus10027277 [exp]	29.7	0.6669
AT5G42850			Thioredoxin superfamily protei...		Lus10037477 [exp]	32.6	0.7124
AT4G13200			unknown protein		Lus10022803 [exp]	35.9	0.6992

Compare expression of checked genes

Lus10035888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.