Plant FIBer expression Database

Lus10035895 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79990 116 / 8e-35 structural molecules (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037528
[exp]
125 / 6e-35 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
Lus10011465
[exp]
102 / 1e-26 AT1G10050 807 / 0.0 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G056100
[exp]
125 / 3e-38 AT1G79990 223 / 5e-76 structural molecules (.1.2.3.4.5)
Potri.001G179500
[exp]
120 / 3e-36 AT1G79990 222 / 1e-75 structural molecules (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09801 SYS1 Integral membrane protein S linking to the trans Golgi network
Representative CDS sequence
>Lus10035895 pacid=23141161 polypeptide=Lus10035895 locus=Lus10035895.g ID=Lus10035895.BGIv1.0 annot-version=v1.0
ATGTTCTATGGTTCAATTGTATGGGATCCATGGCTTATTGTCGCCCAAATCGTGTGCCTTCAATGCCTCTACTACCTCAACCTTGGATTCTTCCTCTCTG
TTTTTGTTGGCACCCGCGTTTCTCGACTTAGTCTGGTCTATTTCTTTGATTTCGCCACGATCACGGCCTCCTCGGTTACTGGTTGGTGCGTTATTGCCTC
CTTCTTACTCAGCTCCCTAGCCGGACATTTAGCTACACTCAATTGCCAGAATTTGTCTGAACGGTTGACAACTAATATCCATTTATGTGAACAATAG
AA sequence
>Lus10035895 pacid=23141161 polypeptide=Lus10035895 locus=Lus10035895.g ID=Lus10035895.BGIv1.0 annot-version=v1.0
MFYGSIVWDPWLIVAQIVCLQCLYYLNLGFFLSVFVGTRVSRLSLVYFFDFATITASSVTGWCVIASFLLSSLAGHLATLNCQNLSERLTTNIHLCEQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79990 structural molecules (.1.2.3.4... Lus10035895
[exp]
0 1
AT3G28715 ATPase, V0/A0 complex, subunit... Lus10005252
[exp]
3.0 0.8780
AT3G02090 MPPBETA Insulinase (Peptidase family M... Lus10040886
[exp]
4.9 0.8327
AT4G08960 phosphotyrosyl phosphatase act... Lus10040491
[exp]
8.9 0.8525
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10028977
[exp]
13.2 0.8466
AT2G26730 Leucine-rich repeat protein ki... Lus10017756
[exp]
15.3 0.8420
AT2G27030 CAM5, CAM2, ACA... calmodulin 5 (.1.2.3) Lus10037423
[exp]
16.7 0.8454
AT3G08670 unknown protein Lus10025209
[exp]
18.3 0.8403
AT3G11320 Nucleotide-sugar transporter f... Lus10009878
[exp]
19.1 0.8032
AT1G59900 AT-E1 ALPHA, AT... pyruvate dehydrogenase complex... Lus10030820
[exp]
20.6 0.8463
AT4G15415 ATB'GAMMA, ATB'... Protein phosphatase 2A regulat... Lus10014619
[exp]
21.2 0.7825

Lus10035895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.