Lus10035917 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80230 171 / 8e-55 Rubredoxin-like superfamily protein (.1)
AT3G15640 149 / 3e-46 Rubredoxin-like superfamily protein (.1.2)
AT1G52710 103 / 2e-29 Rubredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025745 194 / 2e-64 AT1G80230 161 / 3e-51 Rubredoxin-like superfamily protein (.1)
Lus10011494 179 / 6e-59 AT1G80230 148 / 5e-47 Rubredoxin-like superfamily protein (.1)
Lus10023135 116 / 5e-34 AT1G80230 90 / 9e-24 Rubredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G173800 173 / 7e-56 AT1G80230 162 / 2e-51 Rubredoxin-like superfamily protein (.1)
Potri.003G060100 167 / 1e-53 AT1G80230 167 / 2e-53 Rubredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0045 Rubredoxin PF01215 COX5B Cytochrome c oxidase subunit Vb
Representative CDS sequence
>Lus10035917 pacid=23141214 polypeptide=Lus10035917 locus=Lus10035917.g ID=Lus10035917.BGIv1.0 annot-version=v1.0
ATGTGGAGAAGAACAGTTTGTTCTCATCTCAAAACCCTAGCAGCCACCGGCGCAGCCTCCTCATCTTTGCCCTCCCGATTGCCTAGCGCCAACAGATCCT
TAATCTCCCCGGGAGTCTCTTCTTCTCTATTCAACCGCTATTTCAGTGCCGGCGAAGATGGTGCATTGAAAAAGAGTGTTGAGGATGTGGTGCCTATTGC
CACTGGCCATGAACGTGAAGAACTGGAAGCTGAATTGCAGGGAAAGAACCTTCTCGACATTAACTTTCCTGTCAGTCCATTTGGCACAAAGGAGGAACCT
GCTGTCATCAAGTCTTACTATGACAGGAGGATCGTTGGATGCCCTGGTGGTGAAGAAGAGGATGAGCATGATGTTGTGTGGTTTTGGTTGGAGAAAGGCC
AGCATGTTGAATGCACTGTATGCTCACACTACTTTGTTCTCGAAGTTGTTGGCCCTGGAGGAGACCCTGAGGCTGGACATGGTGATGAGCATCATCACTA
A
AA sequence
>Lus10035917 pacid=23141214 polypeptide=Lus10035917 locus=Lus10035917.g ID=Lus10035917.BGIv1.0 annot-version=v1.0
MWRRTVCSHLKTLAATGAASSSLPSRLPSANRSLISPGVSSSLFNRYFSAGEDGALKKSVEDVVPIATGHEREELEAELQGKNLLDINFPVSPFGTKEEP
AVIKSYYDRRIVGCPGGEEEDEHDVVWFWLEKGQHVECTVCSHYFVLEVVGPGGDPEAGHGDEHHH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80230 Rubredoxin-like superfamily pr... Lus10035917 0 1
AT4G00550 DGD2 digalactosyl diacylglycerol de... Lus10040927 1.7 0.8261
AT1G79400 ATCHX2 cation/H+ exchanger 2, cation/... Lus10026155 2.6 0.7421
AT3G24040 Core-2/I-branching beta-1,6-N-... Lus10011765 3.5 0.8128
AT4G39220 ATRER1A Rer1 family protein (.1) Lus10028317 3.9 0.7703
AT5G65000 Nucleotide-sugar transporter f... Lus10026182 11.4 0.7378
AT3G10300 Calcium-binding EF-hand family... Lus10042037 12.3 0.7614
AT2G39290 PGP1, PGS1, PGP... phosphatidylglycerolphosphate ... Lus10023471 12.8 0.7549
AT5G14000 NAC ANAC084 NAC domain containing protein ... Lus10032004 14.5 0.6956
AT1G12390 Cornichon family protein (.1) Lus10028906 18.3 0.7424
AT5G49210 unknown protein Lus10043148 19.7 0.6799

Lus10035917 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.