Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10470 310 / 9e-98 KAC1, KCA1 KINESIN CDKA;1 ASSOCIATED 1, kinesin like protein for actin based chloroplast movement 1 (.1.2) AT5G65460 293 / 1e-91 KAC2, KCA2 kinesin CDKA ;1 associated 2, kinesin like protein for actin based chloroplast movement 2 (.1) AT2G22610 92 / 4e-21 Di-glucose binding protein with Kinesin motor domain (.1.2) AT5G27550 91 / 7e-21 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G72250 86 / 5e-19 Di-glucose binding protein with Kinesin motor domain (.1.2) AT1G73860 86 / 5e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G27000 84 / 2e-18 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) AT1G18410 83 / 4e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G41310 77 / 4e-16 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT3G10310 77 / 5e-16 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025721 [exp] 451 / 2e-150 AT5G10470 1845 / 0.0 KINESIN CDKA;1 ASSOCIATED 1, kinesin like protein for actin based chloroplast movement 1 (.1.2) Lus10035954 [exp] 89 / 3e-20 AT2G22610 1302 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10009667 [exp] 86 / 3e-19 AT1G73860 342 / 2e-108 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009028 [exp] 85 / 1e-18 AT1G63640 351 / 5e-103 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10015212 [exp] 84 / 2e-18 AT5G27000 924 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Lus10029865 [exp] 81 / 2e-17 AT5G27000 1014 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Lus10020682 [exp] 81 / 3e-17 AT1G09170 843 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Lus10004487 [exp] 80 / 6e-17 AT5G27550 881 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10025708 [exp] 79 / 2e-16 AT2G22610 1238 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G010700 [exp] 319 / 3e-101 AT5G10470 1840 / 0.0 KINESIN CDKA;1 ASSOCIATED 1, kinesin like protein for actin based chloroplast movement 1 (.1.2) Potri.011G140000 [exp] 90 / 2e-20 AT1G72250 1201 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.015G047400 [exp] 85 / 7e-19 AT1G63640 908 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.001G436200 [exp] 85 / 9e-19 AT1G72250 1248 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.013G011500 [exp] 84 / 1e-18 AT5G27000 1081 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Potri.005G030271 [exp] 82 / 7e-18 AT5G27550 865 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.006G048650 [exp] 81 / 2e-17 AT3G10310 503 / 2e-169 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.005G021100 [exp] 81 / 3e-17 AT2G47500 1051 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.002G201000 [exp] 80 / 5e-17 AT2G47500 1237 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.003G127800 [exp] 80 / 5e-17 AT1G63640 1065 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00225 [flax] [poplar] Kinesin Kinesin motor domain
Representative CDS sequence Show only first row Show all	>Lus10035941 pacid=23141015 polypeptide=Lus10035941 locus=Lus10035941.g ID=Lus10035941.BGIv1.0 annot-version=v1.0 ATGGCGGAGCAGAAGAGCAGATGGAACTGGGAGGTCACTGGATTTCAACCTAGAAATTCATCCGCATCTGTAGATGCCGATGAGCAGCAGCAGAATCAGA GTGTCATTTCTCCTAACCTTCGGCGATTCTCGATCTCTTCCACTGTCCCTTCAGTTTTGCCATCTAGAAACTTCAATTCCAAACCCGGCCTTGTCCCTAA GCTCCACAAACTGACTGATAAAGTTAAGCTAGCAAAGGAAGAATACTTGGAGTTGAGACAAGAAGCAAGTGATCTGCAGGAGTATTCTAATGCAAAGCTT GATCGGGTCACGCGTTACCTTGGAGTTCTTGCTGAGAAAAGTCGCAAGCTAGATCAAGTCGCTCTTGAAAGTGAGGCTAGAATATCTCCTCTGATCAATG AGAAAAAGCGCTTGTTTAATGAATTGGTGACAACCAAAGGAAACATTAAAGTATTGTGTCGTGCAAGACCATTATTTGAAGACGAAGGTCATTCTATTGT TGAATTTCCTGATGAATCTACCATCCGTGTCAGTACTGGTGATGATGCCTTCTCAAATCCCAAGAAGGATTTTGAATTTGACAGAGTTTATGGTCCTCAT GTTGGACAAGCTGAAATCTTCAGTGATGTGCAGCCCTTCGTGCAATCAGCTCTGGATGGTTATAATGTCAAACAGAGGGGAAATGTTCTGCACCATTAG
AA sequence Show only first row Show all	>Lus10035941 pacid=23141015 polypeptide=Lus10035941 locus=Lus10035941.g ID=Lus10035941.BGIv1.0 annot-version=v1.0 MAEQKSRWNWEVTGFQPRNSSASVDADEQQQNQSVISPNLRRFSISSTVPSVLPSRNFNSKPGLVPKLHKLTDKVKLAKEEYLELRQEASDLQEYSNAKL DRVTRYLGVLAEKSRKLDQVALESEARISPLINEKKRLFNELVTTKGNIKVLCRARPLFEDEGHSIVEFPDESTIRVSTGDDAFSNPKKDFEFDRVYGPH VGQAEIFSDVQPFVQSALDGYNVKQRGNVLHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10470		KAC1, KCA1	KINESIN CDKA;1 ASSOCIATED 1, k...		Lus10035941 [exp]	0	1
AT5G27970			ARM repeat superfamily protein...		Lus10004116 [exp]	1.0	0.9812
AT3G12590			unknown protein		Lus10001699 [exp]	1.7	0.9720
AT2G36850		CHOR, ATGSL8, A...	CHORUS, glucan synthase-like 8...		Lus10040892 [exp]	4.5	0.9724
AT5G27970			ARM repeat superfamily protein...		Lus10004117 [exp]	4.5	0.9712
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	6.0	0.9685
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10001859 [exp]	6.5	0.9710
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	6.6	0.9713
AT3G54280		RGD3, ATBTAF1, ...	ROOT GROWTH DEFECTIVE 3, DNA b...		Lus10013625 [exp]	7.0	0.9699
AT3G12590			unknown protein		Lus10005160 [exp]	7.5	0.9524
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	9.8	0.9690

Compare expression of checked genes

Lus10035941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.