Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39725 128 / 2e-40 LYR family of Fe/S cluster biogenesis protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025710 [exp] 172 / 1e-57 AT2G39725 128 / 3e-40 LYR family of Fe/S cluster biogenesis protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G018100 [exp] 132 / 1e-41 AT2G39725 121 / 2e-37 LYR family of Fe/S cluster biogenesis protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [flax] [poplar] LYR-like PF05347 [flax] [poplar] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Lus10035952 pacid=23141016 polypeptide=Lus10035952 locus=Lus10035952.g ID=Lus10035952.BGIv1.0 annot-version=v1.0 ATGGGCGCATCCAGGCTGTCCGGGATGCAGAAGCAAGTTCTGAGCCTCTACCGAGGGTTTCTCCGAGCTGCCCGTTTGAAATCTGCGGACGAACGGAAGC AGATCGAAACCATTGTATCGGCAGAGTTCCGCCGAAACTCGAAGCATGTGGATCGGAAGAATTTTGTGTACGTTGAGTACTTGCTCAACCGTGGGAAGAA GCAGCTAGATCAGCTCAAGAGCCCAGGCGTCGTTGGATTATCATCTTTCAATGTCGGCCGATCCTGA
AA sequence Show only first row Show all	>Lus10035952 pacid=23141016 polypeptide=Lus10035952 locus=Lus10035952.g ID=Lus10035952.BGIv1.0 annot-version=v1.0 MGASRLSGMQKQVLSLYRGFLRAARLKSADERKQIETIVSAEFRRNSKHVDRKNFVYVEYLLNRGKKQLDQLKSPGVVGLSSFNVGRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39725			LYR family of Fe/S cluster bio...		Lus10035952 [exp]	0	1
AT5G67590		FRO1	FROSTBITE1, NADH-ubiquinone ox...		Lus10011547 [exp]	3.5	0.9128
AT4G33740			unknown protein		Lus10020507 [exp]	4.0	0.9297
					Lus10005395 [exp]	4.5	0.9258
					Lus10026715 [exp]	8.4	0.9124
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10019531 [exp]	9.4	0.9079
AT5G54510		DFL1, GH3.6	DWARF IN LIGHT 1, Auxin-respon...		Lus10018510 [exp]	9.5	0.9036
AT5G10830			S-adenosyl-L-methionine-depend...		Lus10024476 [exp]	13.0	0.9129
					Lus10005397 [exp]	14.2	0.9093
					Lus10015758 [exp]	16.4	0.9094
AT2G39200		ATMLO12, MLO12	MILDEW RESISTANCE LOCUS O 12, ...		Lus10040388 [exp]	20.5	0.8894

Compare expression of checked genes

Lus10035952 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.