Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08710 470 / 3e-165 RUG1 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G63860 181 / 1e-52 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G12350 151 / 9e-40 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G27060 134 / 2e-35 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G02510 130 / 6e-34 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT3G47660 134 / 7e-34 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G60870 127 / 5e-33 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT5G16040 125 / 3e-32 Regulator of chromosome condensation (RCC1) family protein (.1) AT1G69710 122 / 8e-30 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 121 / 2e-29 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039618 [exp] 168 / 1e-47 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10029536 [exp] 144 / 2e-38 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10036030 [exp] 137 / 6e-35 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10033543 [exp] 133 / 6e-35 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10042215 [exp] 131 / 5e-34 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10009701 [exp] 132 / 2e-33 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10017581 [exp] 128 / 4e-33 AT3G02510 636 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10036737 [exp] 129 / 4e-32 AT1G69710 974 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10037192 [exp] 126 / 2e-31 AT1G69710 986 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G071000 [exp] 529 / 0 AT5G08710 515 / 0.0 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.007G100200 [exp] 182 / 5e-53 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G101800 [exp] 132 / 7e-35 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.003G197600 [exp] 135 / 2e-34 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.T124906 [exp] 135 / 2e-34 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 134 / 6e-34 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.017G113200 [exp] 129 / 1e-33 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G276900 [exp] 132 / 2e-33 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.001G026900 [exp] 132 / 3e-33 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.015G107000 [exp] 127 / 6e-33 AT1G27060 446 / 1e-156 Regulator of chromosome condensation (RCC1) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10035957 pacid=23141079 polypeptide=Lus10035957 locus=Lus10035957.g ID=Lus10035957.BGIv1.0 annot-version=v1.0 ATGTCTTCTTCTTCTTCTTCTTCCTCTGGATCGAAATTCGCTGCTCTATGGGGTAACGGTGATTATGGCAGGTTGGGATTTGGTAATTTGGATTCTCAAT CAACACCCAAGCCTCTTTTCCCTTCCTCCTTCCGAAACCAAACCCTTAAGTCTATTTCCTGCGGCGGAGCTCACACCCTCTTCTTAACAGAATCTGGGCA AGTTTTTGCCACTGGTCTTAATGATTTTGGACAACTTGGGATATCAGACAATCCTAGTTATGTTACGGAGCCTGTGGAAGTTTCAGTCTTTGATAAAGAA ATTGTGCAAATTTCTGCTGGTTATCATCATTCTGGCGCCGTTACAGTTGATGGAGAACTCTATGTCTGGGGAAGAAATTCAAATGGACAGCTTGGCCTGG GAAAAAAAGCAGGAAAATCAGTGTATCTACCTACTAAAGTAGATTTGTTAGGTGGGATCAGCATTAAAATGGTAGCTCTGGCTTCGGAGCATTCAGTTGC CGTCACTGATGAAGGTGAGGCCTTGAGCTGGGGAGGAGGCAACTCTGGGCAGCTTGGCCATAGCTGTGAATCCGGGATGCTAGGATTGTTGAAAAGCAAG AGTGAATATGTGCCGAGACGTATTAAGAAACTTGAGGGTGTTAAGGTGAAAACGGTTGCTGCTGGCTTGCTTCATACGGCTTGCGTTGATGAAAATGGAT CTGTTTTCGTTTTTGGAGAAAGAGCTCGTTTTGGAGCAGAGAAGAATGCAACTATCCCATCCATGGTTGACGTGCTCCCGTCTTCTGAAGAAGTTGCATG TGGTGGCTATCACACATGTGTTGTCACAGGTTCCGGAGAGCTGTATGCTTGGGGCTCAAATGAAAATGGTTGCCTTGGATTTGGCACCATGGATGCATTT GGTCAGCCAGAAAGAATTGAAGGGCCATTCCTAAAATCCCCAGTTGAAAAGGTATCCTGTGGTTGGAAACACACAGCAGCTATATCGGAAGGAAAAGTGT TCACCTGGGGTTGGGGAGGCTCAAATGGGACATTTTCAGAAGACGGCCATTCCTCTGGAGGCCAACTGGGGCATGGAAGCGACGTGGATTACAGAAACCC AATGGTAGTTAATTTTGGAGAGAAGGTGAGAGCTGTGCAAGTGTCTTGCGGATTCAATCACACTGGAGCTATACTGGAAGGTTAA
AA sequence Show only first row Show all	>Lus10035957 pacid=23141079 polypeptide=Lus10035957 locus=Lus10035957.g ID=Lus10035957.BGIv1.0 annot-version=v1.0 MSSSSSSSSGSKFAALWGNGDYGRLGFGNLDSQSTPKPLFPSSFRNQTLKSISCGGAHTLFLTESGQVFATGLNDFGQLGISDNPSYVTEPVEVSVFDKE IVQISAGYHHSGAVTVDGELYVWGRNSNGQLGLGKKAGKSVYLPTKVDLLGGISIKMVALASEHSVAVTDEGEALSWGGGNSGQLGHSCESGMLGLLKSK SEYVPRRIKKLEGVKVKTVAAGLLHTACVDENGSVFVFGERARFGAEKNATIPSMVDVLPSSEEVACGGYHTCVVTGSGELYAWGSNENGCLGFGTMDAF GQPERIEGPFLKSPVEKVSCGWKHTAAISEGKVFTWGWGGSNGTFSEDGHSSGGQLGHGSDVDYRNPMVVNFGEKVRAVQVSCGFNHTGAILEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08710		RUG1	RCC1/UVR8/GEF-like 1, Regulato...		Lus10035957 [exp]	0	1
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Lus10005934 [exp]	1.4	0.8667
AT4G36980			unknown protein		Lus10019346 [exp]	2.0	0.8658
AT1G80940			unknown protein		Lus10024095 [exp]	3.5	0.8350
AT1G01650		ATSPPL4	ARABIDOPSIS THALIANA SIGNAL PE...		Lus10018834 [exp]	3.7	0.8344
AT1G80940			unknown protein		Lus10041624 [exp]	3.9	0.8435
AT4G26700		ATFIM1	ARABIDOPSIS THALIANA FIMBRIN 1...		Lus10016580 [exp]	5.7	0.8281
AT2G28930		APK1B	protein kinase 1B (.1.2.3)		Lus10005462 [exp]	5.9	0.8361
AT2G35510		SRO1	similar to RCD one 1 (.1)		Lus10035390 [exp]	8.2	0.8381
AT3G03890			FMN binding (.1.2)		Lus10013617 [exp]	9.0	0.8321
AT1G47530			MATE efflux family protein (.1...		Lus10010035 [exp]	10.0	0.7348

Compare expression of checked genes

Lus10035957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.