Lus10035974 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016685 57 / 2e-10 AT5G64440 453 / 2e-152 fatty acid amide hydrolase (.1)
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01425 Amidase Amidase
Representative CDS sequence
>Lus10035974 pacid=23141116 polypeptide=Lus10035974 locus=Lus10035974.g ID=Lus10035974.BGIv1.0 annot-version=v1.0
ATGATGAACAACAACAAGAAGAGGAGTAGTGCAGCAGAACGCAATATTGATGTGGGTCGCCCTCCGTCGTCGGAAGATCAATCTTATCTCAGTTCCAATG
TCAAAGGTCGGTTCCCTCCCTCCGATCCCTTTCCCGATTGCCGCCGCCTGGCTTCTAGAAATCCGTATGATATGGATAAGATTGCCGGAGGATCTTCAGG
GGGATCAGCTGCAGTAGTGGCTGCTGGACTTTGGGCGGTAGCGCTTGGCGTTGACGGTGGAGGTAATGCATGCATCCGTTCTTCCTCTAAATTGGACGGT
AGGGATGGTTGGGATGCTTAG
AA sequence
>Lus10035974 pacid=23141116 polypeptide=Lus10035974 locus=Lus10035974.g ID=Lus10035974.BGIv1.0 annot-version=v1.0
MMNNNKKRSSAAERNIDVGRPPSSEDQSYLSSNVKGRFPPSDPFPDCRRLASRNPYDMDKIAGGSSGGSAAVVAAGLWAVALGVDGGGNACIRSSSKLDG
RDGWDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64440 ATFAAH fatty acid amide hydrolase (.1... Lus10035974 0 1
Lus10038743 1.0 0.9993
AT1G78980 SRF5 STRUBBELIG-receptor family 5 (... Lus10034790 1.4 0.9964
AT5G46090 Protein of unknown function (D... Lus10018635 2.4 0.9824
AT3G19550 unknown protein Lus10013901 3.5 0.9894
AT3G19550 unknown protein Lus10002114 4.5 0.9884
AT3G19550 unknown protein Lus10002115 5.0 0.9839
AT1G73110 P-loop containing nucleoside t... Lus10024092 6.7 0.9627
Lus10033284 7.2 0.9500
AT1G50380 Prolyl oligopeptidase family p... Lus10032964 7.9 0.9816
AT4G32110 Beta-1,3-N-Acetylglucosaminylt... Lus10042384 8.5 0.9715

Lus10035974 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.