Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71090 130 / 7e-37 Auxin efflux carrier family protein (.1) AT5G01990 84 / 4e-20 Auxin efflux carrier family protein (.1) AT5G65980 70 / 5e-15 Auxin efflux carrier family protein (.1) AT2G17500 63 / 1e-12 Auxin efflux carrier family protein (.1.2.3.4) AT1G76520 62 / 3e-12 Auxin efflux carrier family protein (.1.2) AT1G20925 62 / 3e-12 Auxin efflux carrier family protein (.1) AT1G76530 57 / 1e-10 Auxin efflux carrier family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016705 [exp] 202 / 5e-68 AT1G71090 134 / 2e-37 Auxin efflux carrier family protein (.1) Lus10002280 [exp] 124 / 2e-35 AT1G71090 324 / 9e-109 Auxin efflux carrier family protein (.1) Lus10004059 [exp] 121 / 1e-33 AT1G71090 234 / 3e-72 Auxin efflux carrier family protein (.1) Lus10035610 [exp] 83 / 9e-20 AT5G01990 605 / 0.0 Auxin efflux carrier family protein (.1) Lus10003240 [exp] 84 / 1e-19 AT5G01990 610 / 0.0 Auxin efflux carrier family protein (.1) Lus10035978 [exp] 60 / 2e-11 AT5G65980 486 / 2e-172 Auxin efflux carrier family protein (.1) Lus10001303 [exp] 58 / 1e-10 AT5G65980 491 / 6e-174 Auxin efflux carrier family protein (.1) Lus10012708 [exp] 57 / 1e-10 AT5G65980 494 / 2e-175 Auxin efflux carrier family protein (.1) Lus10016046 [exp] 56 / 6e-10 AT1G20925 392 / 2e-133 Auxin efflux carrier family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G115200 [exp] 152 / 2e-45 AT1G71090 607 / 0.0 Auxin efflux carrier family protein (.1) Potri.008G127700 [exp] 150 / 9e-45 AT1G71090 660 / 0.0 Auxin efflux carrier family protein (.1) Potri.004G093200 [exp] 134 / 1e-38 AT1G71090 513 / 1e-180 Auxin efflux carrier family protein (.1) Potri.017G122400 [exp] 131 / 2e-37 AT1G71090 580 / 0.0 Auxin efflux carrier family protein (.1) Potri.016G141700 [exp] 86 / 1e-20 AT5G01990 622 / 0.0 Auxin efflux carrier family protein (.1) Potri.006G112200 [exp] 82 / 2e-19 AT5G01990 602 / 0.0 Auxin efflux carrier family protein (.1) Potri.005G099300 [exp] 65 / 3e-13 AT2G17500 475 / 2e-167 Auxin efflux carrier family protein (.1.2.3.4) Potri.002G003500 [exp] 62 / 3e-12 AT1G20925 499 / 4e-176 Auxin efflux carrier family protein (.1) Potri.001G456300 [exp] 62 / 3e-12 AT1G76520 382 / 5e-131 Auxin efflux carrier family protein (.1.2) Potri.001G456400 [exp] 59 / 3e-11 AT1G76520 419 / 1e-145 Auxin efflux carrier family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0064 [flax] [poplar] CPA_AT PF03547 [flax] [poplar] Mem_trans Membrane transport protein
Representative CDS sequence Show only first row Show all	>Lus10036001 pacid=23141111 polypeptide=Lus10036001 locus=Lus10036001.g ID=Lus10036001.BGIv1.0 annot-version=v1.0 ATGGCTAGTAATTTGGGGGTATTCTTTGGTCATAATCGAATCATGTCTGATGGGGAAAACCTGCTGACTGCTATTGTTCCGCTGCTTAAACTTCTGTCAA TCACTGTAATTGGATTGATTCTAGCCCACCCAGGAAAGCAAATTATCCCCAGATCGACTTTCAAGCTCCTAAGTAAGCTTGTGTTTGCACTATTTCTACC ATGTTTGATTTTCACGGAGCTGGGTGAATCAATTACGCTCGAAAACATGGCTAAGTGGTGGTTCATCCCAGTCAATGTTGTGATTAGCACTACAATTGGT ATCTTGCTTGGAGTCTACTTGGAGTTTTGGTTGTGGTTATATGTCGTCCTCCTCCACAGCTGA
AA sequence Show only first row Show all	>Lus10036001 pacid=23141111 polypeptide=Lus10036001 locus=Lus10036001.g ID=Lus10036001.BGIv1.0 annot-version=v1.0 MASNLGVFFGHNRIMSDGENLLTAIVPLLKLLSITVIGLILAHPGKQIIPRSTFKLLSKLVFALFLPCLIFTELGESITLENMAKWWFIPVNVVISTTIG ILLGVYLEFWLWLYVVLLHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71090			Auxin efflux carrier family pr...		Lus10036001 [exp]	0	1
AT3G29270			RING/U-box superfamily protein...		Lus10005220 [exp]	1.0	0.9425
AT1G12360		KEU	keule, Sec1/munc18-like (SM) p...		Lus10024558 [exp]	2.8	0.9254
AT1G12360		KEU	keule, Sec1/munc18-like (SM) p...		Lus10032196 [exp]	6.0	0.9121
AT1G54710		ATATG18H	homolog of yeast autophagy 18 ...		Lus10002257 [exp]	9.5	0.9030
AT4G28600		NPGR2	no pollen germination related ...		Lus10003618 [exp]	14.1	0.8952
AT3G14830			unknown protein		Lus10041938 [exp]	16.0	0.9110
AT1G58030		CAT2	cationic amino acid transporte...		Lus10020322 [exp]	19.5	0.8966
AT5G54310		NEV, AGD5	NEVERSHED, ARF-GAP domain 5 (....		Lus10037882 [exp]	19.8	0.8515
AT2G37150			RING/U-box superfamily protein...		Lus10040389 [exp]	20.1	0.9236
AT4G32250			Protein kinase superfamily pro...		Lus10002923 [exp]	22.4	0.8660

Compare expression of checked genes

Lus10036001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.