Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22990 177 / 8e-58 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 171 / 3e-55 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 167 / 6e-54 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 154 / 7e-49 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 153 / 2e-48 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G39700 145 / 3e-45 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 137 / 4e-42 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 132 / 2e-40 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 94 / 5e-25 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 91 / 8e-24 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016708 [exp] 278 / 9e-98 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 219 / 1e-74 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 211 / 1e-70 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 190 / 7e-63 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009115 [exp] 186 / 3e-61 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10019676 [exp] 175 / 6e-57 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 175 / 7e-57 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 164 / 8e-53 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10019789 [exp] 156 / 1e-49 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G114600 [exp] 216 / 4e-73 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 189 / 1e-62 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G079800 [exp] 169 / 1e-54 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 169 / 1e-54 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 164 / 9e-53 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 158 / 2e-50 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 157 / 4e-50 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 153 / 2e-48 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.009G135300 [exp] 152 / 3e-48 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G003700 [exp] 149 / 9e-47 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10036004 pacid=23141162 polypeptide=Lus10036004 locus=Lus10036004.g ID=Lus10036004.BGIv1.0 annot-version=v1.0 ATGGGGTTGCTGGACTCTCTGTCGGATTATTTATCGGAGTTGTTTATCAATGCCAAGCCAGGACGTAAGCGCAGGGCAATGCAGACTGTAGAAATCAAAG TGAAAATGGACTGCGAAGGTTGTGAAAGGAGAGTCCGAAATTATGTACTGCACATGAGAGGGGCGAAATCAGTGGAAGTAAGCAGAAAACAGAGCAGGGT GACGGTGACGGGTTACGTGGAACCAAGCAGGGTGTTGAGGAAAGTACAGAGTACAGGGAAGAAAGCAGAGTTTTGGCCGTACGTGGAGTACAATTTGGTA GCGTACCCATACGCGGCAGGAGCATACGATAAAAAGGCTCCGTCTGGTTACGTGAGAAACGTAGCGCAAGCTCTACCCAGTCACAACTCCACCTCCGAAT CCTATACTGCCATCTTCAGCGACGACAACCCCAATGCTTGCTCTGTTATGTAG
AA sequence Show only first row Show all	>Lus10036004 pacid=23141162 polypeptide=Lus10036004 locus=Lus10036004.g ID=Lus10036004.BGIv1.0 annot-version=v1.0 MGLLDSLSDYLSELFINAKPGRKRRAMQTVEIKVKMDCEGCERRVRNYVLHMRGAKSVEVSRKQSRVTVTGYVEPSRVLRKVQSTGKKAEFWPYVEYNLV AYPYAAGAYDKKAPSGYVRNVAQALPSHNSTSESYTAIFSDDNPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22990		HIPP22	heavy metal associated isopren...		Lus10036004 [exp]	0	1
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10016708 [exp]	1.4	0.8601
AT2G43870			Pectin lyase-like superfamily ...		Lus10002123 [exp]	7.7	0.8192
AT5G05340			Peroxidase superfamily protein...		Lus10006534 [exp]	11.2	0.8123
AT3G58190	AS2	LBD29, ASL16	ASYMMETRIC LEAVES 2-LIKE 16, l...		Lus10033873 [exp]	12.9	0.8412
					Lus10029181 [exp]	13.0	0.7936
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012478 [exp]	13.5	0.8182
AT3G21330	bHLH	bHLH087	basic helix-loop-helix (bHLH) ...		Lus10003500 [exp]	21.0	0.7743
AT5G05340			Peroxidase superfamily protein...		Lus10000346 [exp]	24.5	0.8079
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Lus10026235 [exp]	28.7	0.8280
AT5G54510		DFL1, GH3.6	DWARF IN LIGHT 1, Auxin-respon...		Lus10018510 [exp]	30.9	0.8213

Compare expression of checked genes

Lus10036004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.