Lus10036007 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69940 180 / 7e-56 ATPPME1 Pectin lyase-like superfamily protein (.1)
AT5G07410 177 / 1e-54 Pectin lyase-like superfamily protein (.1)
AT5G61680 171 / 3e-52 Pectin lyase-like superfamily protein (.1)
AT5G07430 152 / 8e-45 Pectin lyase-like superfamily protein (.1)
AT5G07420 144 / 6e-42 Pectin lyase-like superfamily protein (.1)
AT5G47500 87 / 3e-20 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
AT3G06830 84 / 6e-19 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G05310 82 / 1e-18 Pectin lyase-like superfamily protein (.1)
AT5G55590 81 / 4e-18 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1)
AT5G19730 81 / 5e-18 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016711 343 / 2e-119 AT1G69940 400 / 4e-139 Pectin lyase-like superfamily protein (.1)
Lus10034893 132 / 2e-37 AT5G61680 333 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10028364 89 / 5e-21 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1)
Lus10009997 88 / 1e-20 AT5G19730 320 / 1e-107 Pectin lyase-like superfamily protein (.1)
Lus10012942 88 / 2e-20 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10004720 87 / 4e-20 AT5G47500 519 / 0.0 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Lus10041815 86 / 8e-20 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1)
Lus10011132 86 / 1e-19 AT5G19730 575 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10010470 86 / 2e-19 AT1G05310 521 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G114900 214 / 6e-69 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G114266 214 / 6e-69 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G112800 214 / 6e-69 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G113533 214 / 6e-69 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G113433 213 / 2e-68 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.006G186100 202 / 2e-64 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1)
Potri.006G186000 202 / 2e-64 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1)
Potri.015G110700 184 / 2e-57 AT1G69940 393 / 2e-136 Pectin lyase-like superfamily protein (.1)
Potri.006G137100 139 / 1e-39 AT1G69940 355 / 1e-121 Pectin lyase-like superfamily protein (.1)
Potri.014G117100 108 / 5e-28 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10036007 pacid=23141185 polypeptide=Lus10036007 locus=Lus10036007.g ID=Lus10036007.BGIv1.0 annot-version=v1.0
ATGGGTATTCGAGGAGGAGATTTCATGTTTATAACAGTAGTGTTAACGTTACTAGCAGCGGGGTTAAACAAGATTAGTGCGGACGACTTGACACCGATCC
CAGCTGACAAAGCCCAAGTAGAAGCCTGGTTCAAGGCAAACGTGAAGCCATTAGCAGAGCGCAAGGCGACGTTGAACGCCACACTGCTAGCAGCCGAGGC
CAACGCAACAACCATCAAGGTTCGACCCGACGGCAGCGGACAATTCACCACTCTAACCGATGCCATCAACAGCATCCCCAGCGGGAACACCCGGCGTGTC
ATCATAGACTTGGGTTCTGGCCTCTACACGGAGAAAGTCATGATCGAGAGATCCAGACCGTTCATTACCCTGATCGGCGATCCAAAGGCCATGCCCATCT
TGCAGTTTGGCGGCACGGCTAGAGAATTCGGAACCGTGTACAGCGCCACTCTACAGGTCGAGGCTGATTACTTCGTGGCCACGAACATTATTTTCAAAAA
CACGGCGCCTAAGCCCGACGGTACGAAGAAGGGAGAGCAAGCGCTGGCACTGAGGATCGGAGGACACATGGCGACATTCTGA
AA sequence
>Lus10036007 pacid=23141185 polypeptide=Lus10036007 locus=Lus10036007.g ID=Lus10036007.BGIv1.0 annot-version=v1.0
MGIRGGDFMFITVVLTLLAAGLNKISADDLTPIPADKAQVEAWFKANVKPLAERKATLNATLLAAEANATTIKVRPDGSGQFTTLTDAINSIPSGNTRRV
IIDLGSGLYTEKVMIERSRPFITLIGDPKAMPILQFGGTAREFGTVYSATLQVEADYFVATNIIFKNTAPKPDGTKKGEQALALRIGGHMATF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Lus10036007 0 1
Lus10023004 6.9 0.6630
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Lus10006821 8.1 0.6890
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10014880 9.2 0.6740
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10000880 11.5 0.6747
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10028996 15.9 0.6493
AT5G49180 Plant invertase/pectin methyle... Lus10023775 16.7 0.6231
Lus10019580 16.7 0.6601
AT1G53210 sodium/calcium exchanger famil... Lus10017657 19.6 0.6251
AT1G27880 DEAD/DEAH box RNA helicase fam... Lus10015818 23.7 0.5209
Lus10023005 28.6 0.6166

Lus10036007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.