Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61990 65 / 9e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G53330 63 / 4e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53700 56 / 2e-09 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63070 51 / 6e-08 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G20090 50 / 1e-07 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59900 50 / 2e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12775 49 / 2e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G01570 48 / 5e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09900 48 / 8e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G64583 48 / 8e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016725 [exp] 214 / 2e-71 AT5G61990 131 / 4e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007468 [exp] 62 / 2e-11 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028943 [exp] 60 / 4e-11 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009465 [exp] 56 / 2e-09 AT1G31840 640 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10036510 [exp] 54 / 6e-09 AT5G57250 718 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026218 [exp] 54 / 6e-09 AT1G53330 440 / 2e-151 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027916 [exp] 53 / 2e-08 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012068 [exp] 51 / 6e-08 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036238 [exp] 51 / 7e-08 AT4G20090 832 / 0.0 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G105400 [exp] 115 / 3e-30 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G015900 [exp] 64 / 3e-12 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G236800 [exp] 62 / 8e-12 AT5G59900 1071 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G034200 [exp] 61 / 2e-11 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G043101 [exp] 60 / 4e-11 AT5G14770 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G032600 [exp] 56 / 2e-09 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034300 [exp] 52 / 2e-08 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G046200 [exp] 52 / 3e-08 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.004G013300 [exp] 52 / 3e-08 AT3G53700 1092 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G271400 [exp] 51 / 7e-08 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10036019 pacid=23141136 polypeptide=Lus10036019 locus=Lus10036019.g ID=Lus10036019.BGIv1.0 annot-version=v1.0 ATGCTTGGTATCTTTGATGAGATGGTTGCCAAAAATATTGAGCTCGATGAGGTCATGTGGAAGCTGATAATTGATACTTGTTTGAAAGAAAGTAACTTGT TGAAGGCTTTGAAGTTGGTAGATGACATGGCACTGAGCGGTGCAAAAGTAAGTGAAACCATATATGCATTGCTGGTTGATTCCATGTGTGAAACTGAGAG TGTCCTTGAAGACTTCAAATTGCTTGATGAAGCCAATGCACAGCCATTTAGGCTTAGCATTAGTACCTGCAGGACTCTCATTCACGGTCTTCACAGGGCA GGAAGGGCAGACAAAGCAAACAGCTTTTCAGAGGGCATTAGTAGGTTAAATTGGGTTGATGATACCATTCTGCTCAAGAACATCATCAATCAAGACCCAG ATATCCCCAGGAATGAAGGTACAATCAATGATTTGCAGTCAAGAAACTTGGGGGTAGCTTATCAGTCGTGA
AA sequence Show only first row Show all	>Lus10036019 pacid=23141136 polypeptide=Lus10036019 locus=Lus10036019.g ID=Lus10036019.BGIv1.0 annot-version=v1.0 MLGIFDEMVAKNIELDEVMWKLIIDTCLKESNLLKALKLVDDMALSGAKVSETIYALLVDSMCETESVLEDFKLLDEANAQPFRLSISTCRTLIHGLHRA GRADKANSFSEGISRLNWVDDTILLKNIINQDPDIPRNEGTINDLQSRNLGVAYQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53330			Pentatricopeptide repeat (PPR)...		Lus10036019 [exp]	0	1
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10006266 [exp]	4.9	0.8503
AT3G53730			Histone superfamily protein (....		Lus10005896 [exp]	9.1	0.8491
AT4G18470		SNI1	SUPPRESSOR OF NPR1-1, INDUCIBL...		Lus10025429 [exp]	9.7	0.8301
AT1G61000			unknown protein		Lus10012690 [exp]	13.4	0.8276
AT5G35520		MIS12, ATMIS12	MIS12 HOMOLOGUE, ARABIDOPSIS M...		Lus10009652 [exp]	15.5	0.8371
AT3G18520		HDA15, ATHDA15	histone deacetylase 15 (.1.2)		Lus10024919 [exp]	16.6	0.8380
AT1G19980			cytomatrix protein-related (.1...		Lus10017215 [exp]	20.1	0.7817
AT3G49890			unknown protein		Lus10011541 [exp]	21.8	0.7742
AT3G53730			Histone superfamily protein (....		Lus10005898 [exp]	24.1	0.8239
AT1G19100			Histidine kinase-, DNA gyrase ...		Lus10042100 [exp]	25.4	0.7975

Compare expression of checked genes

Lus10036019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.