Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034056 [exp] 0 / 1 AT4G19130 47 / 4e-05 Replication factor-A protein 1-related (.1) Lus10023006 [exp] 0 / 1 ND / Lus10023787 [exp] 0 / 1 ND 44 / 3e-04
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036026 pacid=23141142 polypeptide=Lus10036026 locus=Lus10036026.g ID=Lus10036026.BGIv1.0 annot-version=v1.0 ATGTCGAAGCCTCCTTTAGAACTATCCACGAGCTGCTGGTTATGTATGCTGAAGGAGGGGATCCTGAACCTACATATCGCTGTGTTGCTACAATCCTCAA TTTCGATCGGGAGAAGCATTGGTGTTATCGCGCTTGCCATCCTGTTCCCGGGCTGTCGTAGCAAATGGTCATCATTTCTGGTGCAGCAAACACGACACCG TCCTTCCAGAAGATGTGGCTTACAGATATGGGGCTTGGTCATACAGCGGGCCCTTGCTGCTGCGCTTTCGCCGCCGCAACCACCACGCCAACCAAGCCCA TCTAGACGTCATGACACACATATCCCTCTCGATCCCAACTACGTATTTCCCATCCATACTTATTGTAGGAATAACCCTAATTATTTCTAA
AA sequence Show only first row Show all	>Lus10036026 pacid=23141142 polypeptide=Lus10036026 locus=Lus10036026.g ID=Lus10036026.BGIv1.0 annot-version=v1.0 MSKPPLELSTSCWLCMLKEGILNLHIAVLLQSSISIGRSIGVIALAILFPGCRSKWSSFLVQQTRHRPSRRCGLQIWGLVIQRALAAALSPPQPPRQPSP SRRHDTHIPLDPNYVFPIHTYCRNNPNYF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10036026 [exp]	0	1
AT4G35690			Arabidopsis protein of unknown...		Lus10028382 [exp]	1.0	0.8554
AT3G53010			Domain of unknown function (DU...		Lus10042635 [exp]	2.0	0.8297
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10026617 [exp]	8.5	0.7720
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Lus10041435 [exp]	12.4	0.6216
AT4G16563			Eukaryotic aspartyl protease f...		Lus10028941 [exp]	15.4	0.7279
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017677 [exp]	16.1	0.7717
AT2G28830		AtPUB12	PLANT U-BOX 12 (.1)		Lus10023667 [exp]	16.2	0.7044
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Lus10023691 [exp]	16.7	0.6745
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041829 [exp]	19.2	0.7591
AT1G28440		HSL1	HAESA-like 1 (.1)		Lus10024341 [exp]	20.7	0.6961

Compare expression of checked genes

Lus10036026 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.