Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33700 56 / 1e-10 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT5G52790 55 / 2e-10 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT2G14520 55 / 2e-10 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14230 49 / 2e-08 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT4G14240 49 / 2e-08 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) AT1G47330 49 / 4e-08 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) AT1G03270 45 / 6e-07 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039289 [exp] 66 / 5e-14 AT5G52790 557 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10027528 [exp] 64 / 2e-13 AT5G52790 560 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10039288 [exp] 61 / 2e-12 AT5G52790 449 / 1e-154 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10032715 [exp] 56 / 1e-10 AT1G47330 646 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10020494 [exp] 55 / 4e-10 AT2G14520 538 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10030665 [exp] 54 / 6e-10 AT2G14520 498 / 3e-178 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10005259 [exp] 54 / 7e-10 AT2G14520 679 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012476 [exp] 50 / 2e-08 AT2G14520 591 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Lus10012375 [exp] 49 / 2e-08 AT1G03270 627 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G147900 [exp] 61 / 1e-12 AT5G52790 580 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.009G082300 [exp] 54 / 4e-10 AT2G14520 593 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.001G288000 [exp] 54 / 6e-10 AT2G14520 620 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G196900 [exp] 53 / 1e-09 AT1G47330 575 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.014G012400 [exp] 51 / 4e-09 AT2G14520 516 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1) Potri.010G030200 [exp] 51 / 5e-09 AT4G14240 611 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2) Potri.008G202100 [exp] 49 / 2e-08 AT4G14240 632 / 0.0 CBS domain-containing protein with a domain of unknown function (DUF21) (.1), CBS domain-containing protein with a domain of unknown function (DUF21) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10036040 pacid=23141167 polypeptide=Lus10036040 locus=Lus10036040.g ID=Lus10036040.BGIv1.0 annot-version=v1.0 ATGGAAGAAGACGGAGGAGGACTACTCGGATCCGATGCCGCAGACCCAGTTCATCTAACAAAGAAGAAGAAGAAGAAGAAGACGACGACGACGACGGAAG CCAAGAACTGCAGAGCTGCTTCGGCTAGCCTCCCTCGAACGGAGCTCAAAATCTTGACTGACTTGCATGGAAACGAGTCAGAGAAAGGAGGACAGTTGAC ACATGATGAGACCACAATCATTACTAGAGCTTTGGATATGACTTAG
AA sequence Show only first row Show all	>Lus10036040 pacid=23141167 polypeptide=Lus10036040 locus=Lus10036040.g ID=Lus10036040.BGIv1.0 annot-version=v1.0 MEEDGGGLLGSDAADPVHLTKKKKKKKTTTTTEAKNCRAASASLPRTELKILTDLHGNESEKGGQLTHDETTIITRALDMT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52790			CBS domain-containing protein ...		Lus10036040 [exp]	0	1
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10042755 [exp]	1.4	0.8494
AT4G12420		SKU5	Cupredoxin superfamily protein...		Lus10037941 [exp]	4.5	0.8051
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10030684 [exp]	5.3	0.8858
AT1G55790			Domain of unknown function (DU...		Lus10016345 [exp]	5.8	0.7885
					Lus10037540 [exp]	6.9	0.8424
AT3G19950			RING/U-box superfamily protein...		Lus10032265 [exp]	9.3	0.7636
AT4G25640		FFT, ATDTX35	FLOWER FLAVONOID TRANSPORTER, ...		Lus10039263 [exp]	11.5	0.8318
AT3G49220			Plant invertase/pectin methyle...		Lus10022412 [exp]	15.9	0.7997
AT2G33060		AtRLP27	receptor like protein 27 (.1)		Lus10004313 [exp]	16.0	0.8307
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Lus10016440 [exp]	19.6	0.8231

Compare expression of checked genes

Lus10036040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.